Your shopping cart is currently empty

Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $57 | In Stock | - | |
| 2 mg | $83 | In Stock | - | |
| 5 mg | $137 | In Stock | - | |
| 10 mg | $197 | In Stock | - | |
| 25 mg | $297 | In Stock | - | |
| 50 mg | $443 | Inquiry | Inquiry | |
| 100 mg | $639 | Inquiry | Inquiry |
| Description | Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist. |
| In vivo | Exendin-4 appears to effectively reverse hepatic steatosis in ob/ob mice by improving insulin sensitivity. |
| Synonyms | Extendin-4, Exendin-4 |
| Molecular Weight | 4247 |
| Formula | C186H286N50O62S |
| Cas No. | 141732-76-5 |
| Relative Density. | no data available |
| Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Sequence Short | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Storage | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
| Solubility Information | DMSO: 2.5 mM, Sonication is recommended. | ||||||||||
Solution Preparation Table | |||||||||||
DMSO
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.