Shopping Cart
- Remove All
- Your shopping cart is currently empty
Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $57 | In Stock | |
2 mg | $83 | In Stock | |
5 mg | $137 | In Stock | |
10 mg | $197 | In Stock | |
25 mg | $297 | In Stock | |
50 mg | $443 | In Stock | |
100 mg | $639 | In Stock |
Description | Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist. |
In vivo | Exendin-4 appears to effectively reverse hepatic steatosis in ob/ob mice by improving insulin sensitivity. |
Alias | Extendin-4, Exendin-4 |
Molecular Weight | 4247 |
Formula | C186H286N50O62S |
Cas No. | 141732-76-5 |
Relative Density. | no data available |
Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
Sequence Short | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
Solubility Information | DMSO: 2.5 mM, Sonication is recommended. | ||||||||||
Solution Preparation Table | |||||||||||
DMSO
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.