Shopping Cart
Remove All
Your shopping cart is currently empty
Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $57 | In Stock | - | |
| 2 mg | $83 | In Stock | - | |
| 5 mg | $137 | In Stock | - | |
| 10 mg | $197 | In Stock | - | |
| 25 mg | $297 | In Stock | - | |
| 50 mg | $443 | Inquiry | Inquiry | |
| 100 mg | $639 | Inquiry | Inquiry |
| Description | Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist. |
| In vivo | Exendin-4 appears to effectively reverse hepatic steatosis in ob/ob mice by improving insulin sensitivity. |
| Synonyms | Extendin-4, Exendin-4 |
| Molecular Weight | 4247 |
| Formula | C186H286N50O62S |
| Cas No. | 141732-76-5 |
| Relative Density. | no data available |
| Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Sequence Short | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
| Solubility Information | DMSO: 2.5 mM, Sonication is recommended. | ||||||||||
Solution Preparation Table | |||||||||||
DMSO
| |||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.