Shopping Cart
Remove All
Your shopping cart is currently empty
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $274 | Inquiry | Inquiry | |
| 5 mg | $981 | Inquiry | Inquiry | |
| 10 mg | $1,485 | Inquiry | Inquiry |
| Description | {Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide. |
| Molecular Weight | 3241.7 |
| Formula | NA |
| Relative Density. | no data available |
| Sequence | Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser |
| Sequence Short | VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.