Shopping Cart
- Remove All
- Your shopping cart is currently empty
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $274 | Backorder | |
5 mg | $981 | Backorder | |
10 mg | $1,485 | Backorder |
Description | {Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide. |
Molecular Weight | 3241.7 |
Formula | NA |
Relative Density. | no data available |
Sequence | Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser |
Sequence Short | VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.