Shopping Cart
Remove All
Your shopping cart is currently empty
Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP-1-R) antagonist that regulates blood glucose. Des His1, Glu8 Exendin-4 is used in the study of diabetes and obesity.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $247 | In Stock | In Stock | |
| 5 mg | $543 | In Stock | In Stock | |
| 10 mg | $813 | In Stock | In Stock | |
| 25 mg | $1,380 | In Stock | In Stock | |
| 50 mg | $2,070 | In Stock | In Stock | |
| 100 mg | $2,790 | - | In Stock |
| Description | Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP-1-R) antagonist that regulates blood glucose. Des His1, Glu8 Exendin-4 is used in the study of diabetes and obesity. |
| In vivo | After third ventricle injection of Des His1, Glu8 Exendin-4 (50 μg, 2 μl/15 s), a hyperglycemic response was observed in rats for the first 45 minutes after the intraperitoneal glucose load, and there was a significant increase in insulin levels and insulin area under the curve (AUC) during the IVGTT[1]. |
| Molecular Weight | 4063.46 |
| Formula | C179H277N47O59S |
| Smiles | [H]NCC(N[C@H](C(NCC(N[C@]([H])(C(N[C@@H](CC1=CC=CC=C1)C(N[C@]([H])(C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCSC)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](C)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC2=CC=CC=C2)C(N[C@]([H])(C(N[C@H](C(N[C@@H](CC3=CNC4=C3C=CC=C4)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(NCC(N5CCC[C@H]5C(N[C@H](C(N[C@H](C(NCC(N[C@@H](C)C(N6CCC[C@H]6C(N7CCC[C@H]7C(N8CCC[C@H]8C(N[C@H](C(N)=O)CO)=O)=O)=O)=O)=O)=O)CO)=O)CO)=O)=O)=O)=O)CC(N)=O)=O)CCCCN)=O)CC(C)C)=O)=O)CCC(O)=O)=O)[C@@H](C)CC)=O)=O)CC(C)C)=O)CCCNC(N)=N)=O)C(C)C)=O)=O)CCC(O)=O)=O)CCC(O)=O)=O)CCC(O)=O)=O)=O)CCC(N)=O)=O)CCCCN)=O)CO)=O)CC(C)C)=O)CCC(O)=O)=O)CO)=O)[C@H](O)C)=O)=O)[C@H](O)C)=O)=O)CCC(O)=O)=O |
| Color | White |
| Appearance | Solid |
| Sequence | Gly-Glu-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser |
| Sequence Short | GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Storage | keep away from moisture,store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.