ace2 — TargetMol Chemicals

Cat No.	Product Name	Synonyms	Targets
T13865	Resorcinolnaphthalein		RAAS
	Resorcinolnaphthalein is a specific enhancer of angiotensin-converting enzyme 2 (ACE2) (EC50 value of 19.5 μM).		RAAS
T9109	SSAA09E2		RAAS , SARS-CoV
	SSAA09E2 is a new SARS-CoV replication inhibitor, acting by blocking early interactions of SARS-S with the receptor for SARS-CoV, Angiotensin Converting Enzyme-2 (ACE2).		RAAS , SARS-CoV
T20033	Direct Violet 1	NSC75778,NSC 75778,Airedale Violet ND,NSC-75778,Direct Violet N,CCRIS 2413	SARS-CoV
	Direct Violet 1 (CCRIS 2413) is an agent of dye.		SARS-CoV
T73098	BACE2-IN-1
	BACE2-IN-1, a potent BACE2 inhibitor characterized by its exceptional selectivity and a Ki value of 1.6 nM, is utilized in the investigation of Type 2 Diabetes.
T16116	MLN-4760		RAAS
	MLN-4760 is an angiotensin-converting (ACE2) inhibitor(human ACE2;IC50=0.44 nM). It also has excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypept...		RAAS
TP1622	DX600 TFA		RAAS
	DX600 TFA is a specific inhibitor of ACE2 and does not cross-react with ACE.		RAAS
T2563	Acetyl-L-carnitine hydrochloride	Acetyl L-carnitine hydrochloride,O-Acetylcarnitine,O-acetyl-L-carnitine,O-Acetyl-L-carnitine hydrochloride	Others , Endogenous Metabolite
	Acetyl-L-carnitine hydrochloride (Acetyl L-carnitine hydrochloride) is a nutritional supplement composed of the hydrochloride salt form of the acetylated form of the endogenously produced L-carnitine, with potential neur...		Others , Endogenous Metabolite
T35324	DX600
	DX600 is a useful organic compound for research related to life sciences. The catalog number is T35324 and the CAS number is 478188-26-0.
T37695	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions.
T70985	GL-1001 disodium tetrahydrate
	GL-1001 disodium tetrahydrate is an ACE2 inhibitor.
T70986	GL-1001 sodium salt
	GL-1001 sodium salt is an ACE2 inhibitor.
T76200	STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
	STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1].
T40384	Mca-Ala-Pro-Lys(Dnp)-OH
	Mca-Ala-Pro-Lys(Dnp)-OH, a specific quenched fluorogenic substrate for ACE2, enables the detection of ACE2 activity in various tissues including urinary, heart, and lung.
T76605	Abz-Ser-Pro-3-nitro-Tyr
	Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) [1] .
T76090	Mca-YVADAP-Lys(Dnp)-OH
	Mca-YVADAP-Lys(Dnp)-OH serves as a fluorogenic substrate specifically for caspase-1 and angiotensin-converting enzyme 2 (ACE2) [1].
T81849	MAT-POS-e194df51-1		SARS-CoV
	MAT-POS-e194df51-1 is an orally active, non-covalent, non-peptide inhibitor of the SARS-CoV-2 main protease (M^pro) with an IC_50 of 37nM. It exhibits cytotoxicity, with EC_50 values of 64nM in A549-ACE2-TMPRSS2 cells an...		SARS-CoV
T80048	Mca-YVADAP-Lys(Dnp)-OH TFA
	Mca-YVADAP-Lys(Dnp)-OH TFA serves as a fluorogenic substrate specifically utilized for caspase-1 and angiotensin-converting enzyme 2 (ACE2) [1].
T78770	Garcinone B		Angiotensin-converting Enzyme (ACE)
	Garcinone B, a xanthone derivative naturally isolated from the pericarp of Mangosteen, serves as a potent inhibitor of ACE2 and Mpro, and is utilized in COVID-19 research [1].		Angiotensin-converting Enzyme (ACE)
T72913	(R)-MLN-4760
	(R)-MLN-4760, the R-enantiomer of MLN-4760, functions as an ACE2 inhibitor and exhibits a half maximal inhibitory concentration (IC50) of 8.4 μM, identifying it as the less active isomer.
T80587	Alunacedase alfa	HrsACE2,GSK 2586881	SARS-CoV
	Alunacedase alfa (HrsACE2; GSK 2586881), a genetically modified human recombinant soluble angiotensin-converting enzyme-2 (hrsACE2), inhibits SARS-CoV-2 cell entry by competing with membrane-bound ACE2, offering potentia...		SARS-CoV