exendin

Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.

Exendin-3 4 (64-86) is a polypeptide composed of a specific amino acid sequence within the exendin-3 or exendin-4 peptide chains.

Exendin (5-39) is a potent antagonist of the glucagon-like peptide 1 (GLP-1) receptor that can ameliorate memory impairment in rats treated with β-amyloid protein.

Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours.

Exendin-4 (3-39) is a truncated peptide variant of Exendin-4, missing the initial two amino acids, and serves as a potent agonist for the Glucagon-like peptide-1 receptor (GLP-1r). This compound, along with Exendin-4, is utilized in the study of diabetes and hypothalamic-pituitary-adrenal (HPA) axis disorders [1] [2].

Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP-1-R) antagonist that regulates blood glucose. Des His1, Glu8 Exendin-4 is used in the study of diabetes and obesity.

Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM).

Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

Exendin-3 4 (59-86) is a derivative of the Exendin-4 peptide.

Exendin derivative 1, a 39-amino acid peptide, is a chemical compound known for its significant biological activity and therapeutic potential.

{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.

SDV-Exendin-3 4 is a 32-amino acid peptide. Derived from the salivary gland of the Gila monster (Heloderma suspectum), this peptide is a ligand for the GLP-1 receptor, playing a key role in glucose metabolism and insulin secretion. It exhibits significant potential for therapeutic applications in diabetes management.

Exendin-3 is a biologically active peptide and pancreatic secretagogue from the glucagon family, isolated from the venoms of Gila monster lizards (Heloderma horridurn).

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist.

Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia.

Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.