exendin

Exendin (5-39) is a potent antagonist of the glucagon-like peptide 1 (GLP-1) receptor that can ameliorate memory impairment in rats treated with β-amyloid protein.

Exendin-3/4 (64-86) is a polypeptide composed of a specific amino acid sequence within the exendin-3 or exendin-4 peptide chains.

Exendin-3/4 (59-86) is a derivative of the Exendin-4 peptide.

{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.

SDV-Exendin-3/4 is a 32-amino acid peptide. Derived from the salivary gland of the Gila monster (Heloderma suspectum), this peptide is a ligand for the GLP-1 receptor, playing a key role in glucose metabolism and insulin secretion. It exhibits significant potential for therapeutic applications in diabetes management.

Exendin-3 is a biologically active peptide and pancreatic secretagogue from the glucagon family, isolated from the venoms of Gila monster lizards (Heloderma horridurn).

Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours.

Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM).

Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.

Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist.

Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia.

Exendin-4 (3-39) is a truncated peptide variant of Exendin-4, missing the initial two amino acids, and serves as a potent agonist for the Glucagon-like peptide-1 receptor (GLP-1r). This compound, along with Exendin-4, is utilized in the study of diabetes and hypothalamic-pituitary-adrenal (HPA) axis disorders [1] [2].

Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP-1-R) antagonist that regulates blood glucose. Des His1, Glu8 Exendin-4 is used in the study of diabetes and obesity.

Exendin 4, biotin labeled, is a bioactive peptide.

Exendin-4-Lys-azide TFA (Compound Ex40) is an azide derivative of Exendin-4, which is suitable for conjugation and click chemistry applications.

Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

Exendin derivative 1, a 39-amino acid peptide, is a chemical compound known for its significant biological activity and therapeutic potential.

Exendin-P5, a selective agonist for GLP-1R, enhances the potency of G protein-mediated signaling through rapid activation of G proteins via transient interactions with the GLP-1R transmembrane domain. This action accelerates cAMP production, pointing to Exendin-P5's potential use in researching metabolic diseases.

KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia[1]. [1]. US20150315260 A1

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.