Shopping Cart
- Remove All
- Your shopping cart is currently empty
Exendin-P5, a selective agonist for GLP-1R, enhances the potency of G protein-mediated signaling through rapid activation of G proteins via transient interactions with the GLP-1R transmembrane domain. This action accelerates cAMP production, pointing to Exendin-P5's potential use in researching metabolic diseases.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Exendin-P5, a selective agonist for GLP-1R, enhances the potency of G protein-mediated signaling through rapid activation of G proteins via transient interactions with the GLP-1R transmembrane domain. This action accelerates cAMP production, pointing to Exendin-P5's potential use in researching metabolic diseases. |
Molecular Weight | 4209.65 |
Formula | C185H291N49O61S |
Sequence | Glu-Leu-Val-Asp-Asn-Ala-Val-Gly-Gly-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ala |
Sequence Short | ELVDNAVGGDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPA |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.