Your shopping cart is currently empty

Exendin-P5, a selective agonist for GLP-1R, enhances the potency of G protein-mediated signaling through rapid activation of G proteins via transient interactions with the GLP-1R transmembrane domain. This action accelerates cAMP production, pointing to Exendin-P5's potential use in researching metabolic diseases.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Exendin-P5, a selective agonist for GLP-1R, enhances the potency of G protein-mediated signaling through rapid activation of G proteins via transient interactions with the GLP-1R transmembrane domain. This action accelerates cAMP production, pointing to Exendin-P5's potential use in researching metabolic diseases. |
| Molecular Weight | 4209.65 |
| Formula | C185H291N49O61S |
| Sequence | Glu-Leu-Val-Asp-Asn-Ala-Val-Gly-Gly-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ala |
| Sequence Short | ELVDNAVGGDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPA |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.