Shopping Cart
- Remove All
- Your shopping cart is currently empty
Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $169 | In Stock | |
5 mg | $493 | In Stock | |
10 mg | $692 | In Stock | |
25 mg | $1,070 | In Stock | |
50 mg | $1,450 | In Stock | |
100 mg | $1,950 | In Stock |
Description | Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia. |
Alias | Exendin 9-39 acetate, Avexitide acetate(133514-43-9 Free base) |
Molecular Weight | 3549.91 |
Formula | C155H246N40O53S |
Cas No. | 2051593-46-3 |
Smiles | OC(C[C@@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC1=CNC2=CC=CC=C12)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(NCC(N3[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N4[C@H](C(N5[C@H](C(N6[C@H](C(N[C@H](C(N)=O)CO)=O)CCC6)=O)CCC5)=O)CCC4)=O)C)=O)=O)CO)=O)CO)=O)CCC3)=O)=O)=O)CC(N)=O)=O)CCCCN)=O)CC(C)C)=O)=O)CCC(O)=O)=O)[C@H](CC)C)=O)CC7=CC=CC=C7)=O)CC(C)C)=O)CCCNC(N)=N)=O)C(C)C)=O)C)=O)CCC(O)=O)=O)CCC(O)=O)=O)CCC(O)=O)=O)CCSC)=O)CCC(N)=O)=O)CCCCN)=O)CO)=O)CC(C)C)=O)N)=O.CC(O)=O.CC(O)=O.CC(O)=O |
Sequence | Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
Sequence Short | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
Solubility Information | H2O: 50 mg/mL (14.08 mM), Sonication is recommended. ![]() | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.