Your shopping cart is currently empty

Exendin (5-39) is a potent antagonist of the glucagon-like peptide 1 (GLP-1) receptor that can ameliorate memory impairment in rats treated with β-amyloid protein.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
| Description | Exendin (5-39) is a potent antagonist of the glucagon-like peptide 1 (GLP-1) receptor that can ameliorate memory impairment in rats treated with β-amyloid protein. |
| In vivo | Intracerebroventricular administration of Exendin (5-39) at a dosage of 0.3 μg once daily for a week in male Wistar rats significantly augmented GLT-1 protein levels in the hippocampus. Additionally, hippocampal slices from Exendin (5-39)-treated or vehicle-treated rats demonstrated a decrease in fEPSP decay time, an enhancement in the input-output relationship, and a reduction in the paired-pulse ratio within the dentate gyrus (DG). Moreover, Exendin (5-39) was observed to inhibit long-term depression, albeit without affecting long-term potentiation in the DG. This effect was examined using an animal model comprising Wistar rats aged three weeks and those 18 days into pregnancy, underscoring Exendin (5-39)'s impact on hippocampal synaptic functions. |
| Cas No. | 196109-27-0 |
| Sequence | Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Sequence Short | TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.