Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms:

| Pack Size | Price | EUR Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
| Description | Exendin (5-39) is a selective GLP-1 receptor antagonist used to investigate endogenous glucagon-like peptide-1 signaling. By blocking the GLP-1 receptor, this compound attenuates the anorexigenic effects of GLP-1 and can enhance food intake under ad libitum conditions in certain models. Additionally, chronic administration of exendin (5-39) increases GLT-1 protein levels and glutamate uptake in the hippocampus, leading to decreased fEPSP decay time and inhibited long-term depression in the dentate gyrus. This makes it a valuable tool for studying GLP-1’s role in feeding behavior and its modulation of synaptic transmission and plasticity via astrocytic glutamate transport. |
| In vivo | Intracerebroventricular administration of Exendin (5-39) at a dosage of 0.3 μg once daily for a week in male Wistar rats significantly augmented GLT-1 protein levels in the hippocampus. Additionally, hippocampal slices from Exendin (5-39)-treated or vehicle-treated rats demonstrated a decrease in fEPSP decay time, an enhancement in the input-output relationship, and a reduction in the paired-pulse ratio within the dentate gyrus (DG). Moreover, Exendin (5-39) was observed to inhibit long-term depression, albeit without affecting long-term potentiation in the DG. This effect was examined using an animal model comprising Wistar rats aged three weeks and those 18 days into pregnancy, underscoring Exendin (5-39)'s impact on hippocampal synaptic functions. |
| Cas No. | 196109-27-0 |
| Sequence | Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ |
| Sequence Short | TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Storage | Keep away from direct sunlight,Keep away from moisture,Store under nitrogen, Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.