Shopping Cart
Remove All
Your shopping cart is currently empty
Exendin (5-39) is a potent antagonist of the glucagon-like peptide 1 (GLP-1) receptor that can ameliorate memory impairment in rats treated with β-amyloid protein.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Backorder | Backorder | |
| 500 mg | Inquiry | Backorder | Backorder |
| Description | Exendin (5-39) is a potent antagonist of the glucagon-like peptide 1 (GLP-1) receptor that can ameliorate memory impairment in rats treated with β-amyloid protein. |
| In vivo | Intracerebroventricular administration of Exendin (5-39) at a dosage of 0.3 μg once daily for a week in male Wistar rats significantly augmented GLT-1 protein levels in the hippocampus. Additionally, hippocampal slices from Exendin (5-39)-treated or vehicle-treated rats demonstrated a decrease in fEPSP decay time, an enhancement in the input-output relationship, and a reduction in the paired-pulse ratio within the dentate gyrus (DG). Moreover, Exendin (5-39) was observed to inhibit long-term depression, albeit without affecting long-term potentiation in the DG. This effect was examined using an animal model comprising Wistar rats aged three weeks and those 18 days into pregnancy, underscoring Exendin (5-39)'s impact on hippocampal synaptic functions. |
| Cas No. | 196109-27-0 |
| Sequence | Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Sequence Short | TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.