Shopping Cart
- Remove All
- Your shopping cart is currently empty
Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
500 μg | $135 | In Stock | |
1 mg | $198 | In Stock | |
5 mg | $529 | In Stock | |
10 mg | $753 | In Stock | |
25 mg | $1,130 | In Stock | |
50 mg | $1,530 | In Stock | |
100 mg | $1,980 | Backorder |
Description | Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor. |
Targets&IC50 | GLP1:1.7 nM (Kd), exendin-3:20 nM, GLP1 receptor:< 1.9 μM, GLP1 receptor:200 nM (EC50) |
In vitro | Avexitide (Exendin (9-39)) is a specific GLP-1 receptor antagonist which is a truncated form of the GLP-1 agonist exendin-4. GLP-1 plays a role in the control of fasting glucose. |
In vivo | Continuous subcutaneous infusion of Avexitide (Exendin (9-39)) significantly raises fasting blood glucose levels in SUR-1 mice, without affecting glucose tolerance. |
Synonyms | Exendin-3 (9-39) amide, Exendin (9-39) |
Molecular Weight | 3369.76 |
Formula | C149H234N40O47S |
Cas No. | 133514-43-9 |
Smiles | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(N)=O |
Relative Density. | 1.51g/cm3 |
Sequence | Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
Sequence Short | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
Solubility Information | H2O: 49 mg/mL (14.54 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.