glp-1

antagonist at the human GLP-1 receptor

GLP-1(28-36)amide, a C-terminal nonapeptide derived from the cleavage of GLP-1 by neutral endopeptidase (NEP), is an important compound that functions as an antioxidant primarily targeting the mitochondrion to inhibit mitochondrial permeability transition (MPT), displaying anti-diabetic properties and cardioprotection effects[1].

GLP-1(32-36)amide is a pentapeptide compound derived from the C terminus of the glucoregulatory hormone GLP-1. This compound has shown potential in inhibiting weight gain and regulating glucose metabolism in diabetic mice[1][2].

GLP-1(7-36), amide TFA is a prominent intestinal hormone that stimulates glucose-induced insulin secretion from β cells[1].

The GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide, a glucagon-like peptide 1 receptor (GLP-1) agonist.

Glp-1(7-37) acetate is an intestinal insulin hormone that enhances glucose-induced insulin secretion.

GLP-1 secretion by human enteroendocrine NCI-H716 cells is augmented in a dose-dependent manner by the addition of CPE.

GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.

GLP-1(32-36)amide acetate is a pentapeptide and derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide acetate could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice.

GLP-1 amide is a peptide hormone cleaved from proglucagon in the pancreas.1,2 Mice lacking the glucagon receptor (Gcgr-/-) have approximately nine-fold higher levels of total GLP-1 amide, including GLP-1 (1-36) amide and truncated GLP-1 (7-36) amide , in pancreatic tissue compared to wild-type mice.2References1. Schjoldager, B.T., Mortensen, P.E., Christiansen, J., et al. GLP-1 (glucagon-like peptide 1) and truncated GLP-1, fragments of human proglucagon, inhibit gastric acid secretion in humans. Dig. Dis. Sci. 34(5), 703-708 (1989).2. Gelling, R.W., Du, X.Q., Dichmann, D.S., et al. Lower blood glucose, hyperglucagonemia, and pancreatic α cell hyperplasia in glucagon receptor knockout mice. Proc. Natl. Acad. Sci. U.S.A. 100(3), 1438-1443 (2003). GLP-1 amide is a peptide hormone cleaved from proglucagon in the pancreas.1,2 Mice lacking the glucagon receptor (Gcgr-/-) have approximately nine-fold higher levels of total GLP-1 amide, including GLP-1 (1-36) amide and truncated GLP-1 (7-36) amide , in pancreatic tissue compared to wild-type mice.2 References1. Schjoldager, B.T., Mortensen, P.E., Christiansen, J., et al. GLP-1 (glucagon-like peptide 1) and truncated GLP-1, fragments of human proglucagon, inhibit gastric acid secretion in humans. Dig. Dis. Sci. 34(5), 703-708 (1989).2. Gelling, R.W., Du, X.Q., Dichmann, D.S., et al. Lower blood glucose, hyperglucagonemia, and pancreatic α cell hyperplasia in glucagon receptor knockout mice. Proc. Natl. Acad. Sci. U.S.A. 100(3), 1438-1443 (2003).

GLP-1(28-36)amide acetate inhibits mitochondrial permeability transition with antioxidant, anti-diabetic and cardioprotection activities.

GLP-1(9-36)amide TFA, a predominant metabolite of glucagon-like peptide-1-(7-36)amide synthesized through dipeptidyl peptidase-4 (DPP-4) activity, functions as an antagonist to the human pancreatic GLP-1 receptor [1] [2].

Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human, is a human GLP-1 (7-36) amide biotinylated at the C-terminal.

GLP-1(28-36)amide TFA, a C-terminal nonapeptide derived from GLP-1 cleavage by neutral endopeptidase (NEP), is an antioxidant that targets mitochondria and inhibits mitochondrial permeability transition (MPT), demonstrating anti-diabetic and cardioprotective effects [1].

GLP-1(32-36)amide TFA, a pentapeptide derived from the C-terminal end of the glucoregulatory hormone GLP-1, has demonstrated the ability to mitigate weight gain and regulate glucose metabolism in diabetic mice [1] [2].

(Ser8)-GLP-1 (7-36) amide, human, is a glucagon-like peptide-1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. This entero-insulinotropic hormone promotes glucose-dependent insulin secretion from pancreatic β-cells and affects gastrointestinal motility and secretion [1].

GLP-1 (1-36) amide (human, rat) is a molecular variant of the GLP-1 (7-36) amide and has the capacity to stimulate [14C]aminopyrine accumulation in enzymatically dispersed, enriched rat parietal cells [1].

GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide (glucagon-like peptide-1).GLP-1(7-36), amide is able to activate the GLP-1 receptor, which has the ability to promote insulin secretion and inhibit glucagon secretion, with the potential to treat type 2 diabetes mellitus and obesity.

[Gly8]-GLP-1(7-37) acetate is a derivative of GLP-1, where glycine at position 8 is replaced with alanine. [Gly8]-GLP-1(7-37) acetate is also a peptide fragment of the GLP-1 receptor (GLP-1R) agonist, Dulaglutide.

GIP/GLP-1 dual receptor agonist-1 (Compound 4) (sodium) functions as a GIP/GLP-1 receptor agonist. This compound is applicable for research into metabolic disorders and liver diseases, including non-alcoholic steatohepatitis (NASH) and non-alcoholic fatty liver disease (NAFLD).

GLP-1 (7-36), amide, chicken, common turkey is a polypeptide molecule with the sequence HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2.

[D-Glp1,D-Phe2,D-Trp3,6]-LH-RH, a luteinizing hormone-releasing hormone (LHRH) analogue, acts as a gonadotropin-releasing hormone (GnRH) receptor antagonist [1].

A8SGLP-1, an orally active GLP-1 analogue, features serine substituted for alanine at position 8. It effectively reduces blood glucose in db/db mice, maintaining its function [1].

A8SGLP-1 TFA, an orally active GLP-1 analogue, features a serine substitution for alanine at position 8. This compound effectively lowers blood glucose in db/db mice, maintaining its function [1].