Shopping Cart

Remove All

Your shopping cart is currently empty

Proceed to checkout Continue shopping

GLP-1(7-36), amide

Name: GLP-1(7-36), amide
Brand: TargetMol
SKU: T3984
Rating: 4.5 (1 reviews)

😃Good

Catalog No. T3984Cas No. 107444-51-9

Alias MKC 253, Human GLP-1-(7-36)-amide, Glucagon-like Peptide 1 (7-36) amide, GLP-1(7-36)-amide, GLP-1-(7-36)-amide

GLP-1 secretion by human enteroendocrine NCI-H716 cells is augmented in a dose-dependent manner by the addition of CPE.

GLP-1(7-36), amide

😃Good

Purity: 99.85%

Catalog No. T3984Alias MKC 253, Human GLP-1-(7-36)-amide, Glucagon-like Peptide 1 (7-36) amide, GLP-1(7-36)-amide, GLP-1-(7-36)-amideCas No. 107444-51-9

GLP-1 secretion by human enteroendocrine NCI-H716 cells is augmented in a dose-dependent manner by the addition of CPE.

Pack Size	Price	USA Warehouse	Global Warehouse
1 mg	$185	Inquiry	Inquiry
2 mg	$327	Inquiry	Inquiry
5 mg	$552	Inquiry	Inquiry
10 mg	$793	Inquiry	Inquiry
25 mg	$1,220	Inquiry	Inquiry
50 mg	$1,630	Inquiry	Inquiry
100 mg	$2,220	Inquiry	Inquiry

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Batch Information

Select Batch

Purity:99.85%

Appearance:Solid

Color:White to Yellow

Resource Download

COA HPLC

Product Introduction

Bioactivity

Description	GLP-1 secretion by human enteroendocrine NCI-H716 cells is augmented in a dose-dependent manner by the addition of CPE.
Targets&IC50	GLP1 receptor:0.003 nM (EC50), GLP1 receptor:0.02 nM, Glucagon secretion (isolated islets):2.5 pM
In vitro	METHODS: Human type II lung cells were incubated with GLP-1(7-36)amide (1-1000 nM). 3-isobutyl-1-methylxanthine (0.5 mM) was present during incubation to prevent cAMP hydrolysis. 24 After 1 hour, remove the culture medium and add 1 ml of cold ethanol to lyse the cells. After 1 hour of incubation at 4°C, the wells are scraped and the suspension is centrifuged at 10,000 × g for 10 minutes. The supernatant is removed and evaporated under vacuum. The residues were dissolved in assay buffer and cAMP was measured using a competition binding assay kit (Radiochemistry Center). RESULTS GLP-1(7-36)amide increased cAMP concentration in human type II pneumocytes in a concentration-dependent manner, both in the short and long term. [2]
In vivo	METHODS: Tail vein blood samples were collected from male mice each time 5 minutes before glucose infusion. After glucose infusion, GLP-1(7-36)amide [0.3-10 μ mol, intraventricular (i.c.v)] or normal saline (5 μl) was administered. , i.c.v). RESULTS GLP-1(7-36)amide (0.3-10 nmol, i.c.v) dose-dependently reduced the blood glucose AUC0-50 value by 32.6%. [1] METHODS: A 390-minute intravenous infusion of GLP-1-(7-36)amide was studied in 14 healthy volunteers. After 30 minutes, a solid test meal was provided, and gastric emptying was assessed. Blood was drawn for GLP-1 (total and intact), glucose, insulin, C-peptide, and glucagon measurements. RESULTS Administration of GLP-1-(7-36)amide significantly increased total GLP-1 plasma levels. During infusion of GLP-1-(7-36)amide, plasma concentrations of intact GLP-1 increased to 21 +/- 5 pmol/l. GLP-1-(7-36)amide reduced fasting and postprandial glucose concentrations (P < 0.001) and delayed gastric emptying (P < 0.001). GLP-1-(7-36)amide reduces glucagon levels. [3]
Synonyms	MKC 253, Human GLP-1-(7-36)-amide, Glucagon-like Peptide 1 (7-36) amide, GLP-1(7-36)-amide, GLP-1-(7-36)-amide

Chemical Properties

Molecular Weight	3297.63
Formula	C₁₄₉H₂₂₆N₄₀O₄₅
Cas No.	107444-51-9
Smiles	C([C@@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@@H](CCCNC(=N)N)C(N)=O)=O)=O)CCCCN)=O)C(C)C)=O)CC(C)C)=O)NC([C@@H](NC([C@@H](NC([C@H](CC1=CC=CC=C1)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@H](CC2=CC=C(O)C=C2)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC3=CC=CC=C3)NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@H](CC4=CN=CN4)N)=O)C)=O)CCC(O)=O)=O)=O)[C@@H](C)O)=O)=O)[C@@H](C)O)=O)CO)=O)CC(O)=O)=O)C(C)C)=O)CO)=O)CO)=O)=O)CC(C)C)=O)CCC(O)=O)=O)=O)CCC(N)=O)=O)C)=O)C)=O)CCCCN)=O)CCC(O)=O)=O)=O)[C@H](CC)C)=O)C)=O)C=5C=6C(NC5)=CC=CC6
Relative Density.	1.47 g/cm3
Sequence	His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Sequence Short	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

Storage & Solubility Information

Storage

keep away from moisture | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Solubility Information

DMSO: 10 mM, Sonication is recommended.

Solution Preparation Table

DMSO

	1mg	5mg	10mg	50mg
1 mM	0.3032 mL	1.5162 mL	3.0325 mL	15.1624 mL
5 mM	0.0606 mL	0.3032 mL	0.6065 mL	3.0325 mL
10 mM	0.0303 mL	0.1516 mL	0.3032 mL	1.5162 mL

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc