Shopping Cart
Remove All
Your shopping cart is currently empty
GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $1,980 | 35 days | 35 days |
| Description | GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. |
| Molecular Weight | 3355.67 |
| Formula | C151H228N40O47 |
| Cas No. | 106612-94-6 |
| Relative Density. | 1.48 g/cm3 (Predicted) |
| Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
| Sequence Short | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||
| Solubility Information | H2O: 30 mg/mL (8.94 mM), Sonication and heating are recommended. | |||||||||||||||
Solution Preparation Table | ||||||||||||||||
H2O
| ||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.