nmn

Sulfo-ara-F-NMN is an analogue of nicotinamide mononucleotide (NMN) with cellular permeability. Sulfo-ara-F-NMN was selective to activate SARM1 and inhibited CD38 with an IC50 of about 10 μM. Activation by Sulfo-ara-F-NMN to Z-48 or NMN, which has a higher cyclase activity, causes conformational changes in SARM1, resulting in cADPR production, NAD depletion, and non-apoptotic cell death.

β-nicotinamide mononucleotide (NMN) is a natural nucleotide and a key intermediate in the synthesis of coenzyme I (NAD+). β-nicotinamide mononucleotide is involved in a number of biochemical reactions in the human body, which are related to immunity and metabolism.

SBI-797812 is structurally similar to active-site directed inhibitor of NAMPT(NAMPT with EC50 of 0.37 μM).

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions.

CM-675 is a dual inhibitor of phosphodiesterase 5 (PDE5) and class I histone deacetylases (IC50s: 114 nM and 673 nM for PDE5 and HDAC1) with the potential to treat Alzheimer's disease.

Sigma-1 receptor antagonist 3 is a potent and selective antagonist of Sigma-1 (σ1) receptor(Ki : 1.14 nM), has the potential for the neuropathic pain.

DTT (DL-Dithiothreitol) is a strong reducing agent. DTT has anti-disulfide ptosis activity and, upon oxidation, forms a stable six-membered ring with internal disulfide bonds.

LY2365109 hydrochloride is a potent and selective GlyT1 inhibitor, with an IC50 of 15.8 nM for glycine uptake in cells over-expressing [hGlyT1a].

CDK2-IN-27 (compound 1) is an effective inhibitor of CDK2, exhibiting IC50 values of <10 nM for CDK2/cyclin E1 and >10-20 nM for CDK2/cyclin B1, respectively [1].