Home Tools
Log in
Products Inhibitors Libraries Recombinant Proteins Kits Services Contact Us
Cart
Peptides Monoclonal Antibodies Dye Reagents PROTAC Virtual Screening TargetMol Kits Cell Counting Kit-8 (CCK-8) Inhibitor Cocktails Natural Products Phenols Alkaloids Flavonoids
Inhibitors Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK
Membrane transporter/Ion channel Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Compound Libraries Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD Drug-like Compound Libraries Fragment Libraries Custom Compound Library
Signaling Pathways Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling
DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK Membrane transporter/Ion channel
Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome
Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries
Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD
Drug-like Compound Libraries Compound Libraries for HTS/HCS
Fragment Libraries General Fragment Libraries Characteristic Fragment Libraries Custom Compound Library
TargetMol
Cytokines and Growth Factors •   Cytokines •   Growth Factors Receptor Proteins •   Fc Receptors •   Cytokines and Growth Factor Receptors
CD Proteins •   T Cell CD Proteins •   B Cell CD Proteins Immune Checkpoint Proteins •   Co-inhibitory Immune Checkpoint Proteins •   Co-stimulatory Immune Checkpoint Proteins
CAR-T Therapy Target Proteins •   Hematologic Malignancies Target Proteins •   Solid Tumors Target Proteins Enzymes •   Oxidoreductases,EC 1 •   Transferases,EC 2
Viral Proteins •   Coronavirus (CoV) Proteins •   Influenza Proteins Fluorescent Proteins Others

Search Result

Search Results for " ace2 "

Targets

RAAS

27

Compounds

1

Natural Products

405

Recombinant Proteins

1

Libraries

Cat No. Product Name Synonyms Targets
T13865 Resorcinolnaphthalein RAAS
Resorcinolnaphthalein is a specific enhancer of angiotensin-converting enzyme 2 (ACE2) (EC50 value of 19.5 μM).
T9109 SSAA09E2 RAAS , SARS-CoV
SSAA09E2 is a new SARS-CoV replication inhibitor, acting by blocking early interactions of SARS-S with the receptor for SARS-CoV, Angiotensin Converting Enzyme-2 (ACE2).
T20033 Direct Violet 1 NSC75778,NSC 75778,Airedale Violet ND,NSC-75778,Direct Violet N,CCRIS 2413 SARS-CoV
Direct Violet 1 (CCRIS 2413) is an agent of dye.
T73098 BACE2-IN-1
BACE2-IN-1, a potent BACE2 inhibitor characterized by its exceptional selectivity and a Ki value of 1.6 nM, is utilized in the investigation of Type 2 Diabetes.
T16116 MLN-4760 RAAS
MLN-4760 is an angiotensin-converting (ACE2) inhibitor(human ACE2;IC50=0.44 nM). It also has excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypept...
TP1622 DX600 TFA RAAS
DX600 TFA is a specific inhibitor of ACE2 and does not cross-react with ACE.
T35324 DX600
DX600 is a useful organic compound for research related to life sciences. The catalog number is T35324 and the CAS number is 478188-26-0.
T37695 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions.
T70985 GL-1001 disodium tetrahydrate
GL-1001 disodium tetrahydrate is an ACE2 inhibitor.
T70986 GL-1001 sodium salt
GL-1001 sodium salt is an ACE2 inhibitor.
T76200 STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1].
T40384 Mca-Ala-Pro-Lys(Dnp)-OH
Mca-Ala-Pro-Lys(Dnp)-OH, a specific quenched fluorogenic substrate for ACE2, enables the detection of ACE2 activity in various tissues including urinary, heart, and lung.
T76605 Abz-Ser-Pro-3-nitro-Tyr
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) [1] .
T76090 Mca-YVADAP-Lys(Dnp)-OH
Mca-YVADAP-Lys(Dnp)-OH serves as a fluorogenic substrate specifically for caspase-1 and angiotensin-converting enzyme 2 (ACE2) [1].
T81849 MAT-POS-e194df51-1 SARS-CoV
MAT-POS-e194df51-1 is an orally active, non-covalent, non-peptide inhibitor of the SARS-CoV-2 main protease (M^pro) with an IC_50 of 37nM. It exhibits cytotoxicity, with EC_50 values of 64nM in A549-ACE2-TMPRSS2 cells an...
T80048 Mca-YVADAP-Lys(Dnp)-OH TFA
Mca-YVADAP-Lys(Dnp)-OH TFA serves as a fluorogenic substrate specifically utilized for caspase-1 and angiotensin-converting enzyme 2 (ACE2) [1].
T78770 Garcinone B Angiotensin-converting Enzyme (ACE)
Garcinone B, a xanthone derivative naturally isolated from the pericarp of Mangosteen, serves as a potent inhibitor of ACE2 and Mpro, and is utilized in COVID-19 research [1].
T72913 (R)-MLN-4760
(R)-MLN-4760, the R-enantiomer of MLN-4760, functions as an ACE2 inhibitor and exhibits a half maximal inhibitory concentration (IC50) of 8.4 μM, identifying it as the less active isomer.
T80587 Alunacedase alfa HrsACE2,GSK 2586881 SARS-CoV
Alunacedase alfa (HrsACE2; GSK 2586881), a genetically modified human recombinant soluble angiotensin-converting enzyme-2 (hrsACE2), inhibits SARS-CoV-2 cell entry by competing with membrane-bound ACE2, offering potentia...
T36655 Anti-Spike-RBD mAb
Anti-Spike-RBD mAb is a CHO cell derived human monoclonal IgG1 antibody. Blocking the interaction of spike protein and ACE2 is a potential therapeutic approach for SARS-CoV-2 treatment[1]. [1]. Chunyan Wang, et al. A Hum...
T76851 Regdanvimab
Regdanvimab (CT-P59) is a human monoclonal antibody designed to target the receptor-binding domain of the SARS-CoV-2 spike protein, thereby inhibiting the virus's ability to enter cells by blocking its interaction with t...
T81206 SARS-CoV-2-IN-65 SARS-CoV
SARS-CoV-2-IN-65 (compound 2f (81)) is a potent, orally active reversible inhibitor of SARS-CoV-2 entry, primarily obstructing the RBD:ACE2 interaction and TMPRSS2 activity within the ACE2-dependent pathway in Calu-3 cel...
T36876 SBP1
Human ACE2 receptor-derived 23-amino acid peptide. Binds receptor binding domain (RBD) of insect-derived SARS-CoV-2 spike protein (KD = 1.3 μM for N-terminal biotinylated, insect-derived spike protein RBD; see Zhang et a...
T36435 SP 10
Peptide originally derived from SARS-CoV Spike (S) protein; corresponds to amino acid residues 668 to 679. Highly potent inhibitor of SARS-CoV S protein and ACE2 interaction (IC50 = 1.88 nM in biochemical assay). Inhibit...
T36942 SSAA09E1 SSAA09E1
SSAA09E1 is an inhibitor of severe acute respiratory syndrome coronavirus (SARS-CoV) viral entry.1It reduces infection of HEK293T cells transiently transfected with angiotensin-converting enzyme 2 (ACE2) by an HIV-based ...
T36877 SBP1-FITC SBP1-FITC
Fluorescently labelled peptide derived from human ACE2 (SBP1, Cat. No. 7233). Composed of SBP1 conjugated to FITC (Fluorescein-5-isothiocyanate; Cat. No. 5440). SBP1 binds receptor binding domain (RBD) of insect-derived ...
T83742 SBP1 TFA Spike Binding Peptide 1
Spike Binding Peptide 1 (SBP1), representing amino acids 21-43 of angiotensin-converting enzyme 2 (ACE2), has been utilized in a novel approach involving lipid nanoparticles (LNPs) encapsulated with oseltamivir phosphate...
Cat No. Product Name Synonyms Targets
T2563 Acetyl-L-carnitine hydrochloride Acetyl L-carnitine hydrochloride,O-Acetylcarnitine,O-acetyl-L-carnitine,O-Acetyl-L-carnitine hydrochloride Others , Endogenous Metabolite
Acetyl-L-carnitine hydrochloride (Acetyl L-carnitine hydrochloride) is a nutritional supplement composed of the hydrochloride salt form of the acetylated form of the endogenously produced L-carnitine, with potential neur...

Natural Products

Acetyl-L-carnitine hydrochloride
T2563
Synonym: Acetyl L-carnitine hydrochloride,O-Acetylcarnitine,O-acetyl-L-carnitine,O-Acetyl-L-carnitine hydrochloride
Target: Others, Endogenous Metabolite

Recombinant Proteins

Species：
SARS-CoV-2 (337)
SARS (18)
Human (14)
MERS-CoV (8)
HCoV-HKU1 (5)
HCoV-OC43 (4)
Mouse (4)
HCoV-229E (3)
HCoV-NL63 (3)
Cynomolgus (2)
Expression System：
HEK293 (332)
Baculovirus-Insect Cells (67)
E. coli (2)
Human Cells (1)
in vitro E. coli expression system (1)
Tag：
His (187)
Tag Free (124)
His,AVI (34)
C-His-Avi (15)
rFc (9)
Fc (8)
C-hFc-Avi (6)
His (5)
mFc (4)
hFc (3)
Cat No. Product Name Species Expression System
TMPK-00383 ACE2/ACEH Protein, Human, Recombinant (His & Avi) Human HEK293
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio...
TMPK-00552 ACE2/ACEH Protein, Cynomolgus, Recombinant (His & Avi), Biotinylated Cynomolgus HEK293
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio...
TMPK-00551 ACE2/ACEH Protein, Cynomolgus, Recombinant (His & Avi) Cynomolgus HEK293
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio...
TMPK-00382 ACE2/ACEH Protein, Human, Recombinant (hFc & Avi), Biotinylated Human HEK293
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio...
TMPJ-00386 ACE2/ACEH Protein, Human, Recombinant (HEK293, His & Avi), Biotinylated Human Human Cells
Angiotensin-Converting Enzyme 2 (ACE-2) is an integral membrane protein and a zinc metalloprotease of the ACE family, the ACE family includes somatic and germinal ACE. ACE-2 cleaves angiotensins I and II as a carboxypept...
TMPY-03830 ACE2/ACEH Protein, Rhesus, Recombinant (His) Rhesus HEK293
Angiotensin-converting enzyme 2 (ACE2), a first homolog of ACE, regulates the renin angiotensin system (RAS) by counterbalancing ACE activity. Accumulating evidence in recent years has demonstrated a physiological and pa...
TMPY-03561 ACE2/ACEH Protein, Rhesus, Recombinant (hFc) Rhesus HEK293
Angiotensin-converting enzyme 2 (ACE2), a first homolog of ACE, regulates the renin angiotensin system (RAS) by counterbalancing ACE activity. Accumulating evidence in recent years has demonstrated a physiological and pa...
TMPH-03081 ACE2 Protein, Paguma larvata, Recombinant (hFc) Paguma larvata HEK293
Essential counter-regulatory carboxypeptidase of the renin-angiotensin hormone system that is a critical regulator of blood volume, systemic vascular resistance, and thus cardiovascular homeostasis. Converts angiotensin ...
TMPY-05266 ACE2/ACEH Protein, Human, Recombinant (His) Human HEK293
Angiotensin-converting enzyme 2 (ACE2), a first homolog of ACE, regulates the renin angiotensin system (RAS) by counterbalancing ACE activity. Accumulating evidence in recent years has demonstrated a physiological and pa...
TMPY-00655 ACE2/ACEH Protein, Human, Recombinant (hFc) Human HEK293
Angiotensin-converting enzyme 2 (ACE2), a first homolog of ACE, regulates the renin angiotensin system (RAS) by counterbalancing ACE activity. Accumulating evidence in recent years has demonstrated a physiological and pa...
TMPY-02207 ACE2/ACEH Protein, Rat, Recombinant (His) Rat HEK293
Angiotensin-converting enzyme 2 (ACE2), a first homolog of ACE, regulates the renin angiotensin system (RAS) by counterbalancing ACE activity. Accumulating evidence in recent years has demonstrated a physiological and pa...
TMPY-04312 ACE2/ACEH Protein, Human, Recombinant (mFc) Human HEK293
Angiotensin-converting enzyme 2 (ACE2), a first homolog of ACE, regulates the renin angiotensin system (RAS) by counterbalancing ACE activity. Accumulating evidence in recent years has demonstrated a physiological and pa...
TMPY-01838 ACE2/ACEH Protein, Mouse, Recombinant (His) Mouse HEK293
Angiotensin-converting enzyme 2 (ACE2), a first homolog of ACE, regulates the renin angiotensin system (RAS) by counterbalancing ACE activity. Accumulating evidence in recent years has demonstrated a physiological and pa...
TMPY-01839 ACE2/ACEH Protein, Mouse, Recombinant (His & hFc) Mouse HEK293
Angiotensin-converting enzyme 2 (ACE2), a first homolog of ACE, regulates the renin angiotensin system (RAS) by counterbalancing ACE activity. Accumulating evidence in recent years has demonstrated a physiological and pa...
TMPY-05696 ACE2/ACEH Protein, Human, Recombinant (His), Biotinylated Human HEK293
Angiotensin-converting enzyme 2 (ACE2), a first homolog of ACE, regulates the renin angiotensin system (RAS) by counterbalancing ACE activity. Accumulating evidence in recent years has demonstrated a physiological and pa...
TMPY-06334 ACE2/ACEH Protein, Human, Recombinant (hFc), Biotinylated Human HEK293
Angiotensin-converting enzyme 2 (ACE2), a first homolog of ACE, regulates the renin angiotensin system (RAS) by counterbalancing ACE activity. Accumulating evidence in recent years has demonstrated a physiological and pa...
TMPY-05725 ACE2/ACEH Protein, Human, Recombinant (His & Avi), Biotinylated Human Baculovirus-Insect Cells
Angiotensin-converting enzyme 2 (ACE2), a first homolog of ACE, regulates the renin angiotensin system (RAS) by counterbalancing ACE activity. Accumulating evidence in recent years has demonstrated a physiological and pa...
TMPY-03065 BACE2 Protein, Mouse, Recombinant (His) Mouse HEK293
BACE2, also known as beta secretase 2, belongs to the peptidase A1 family. It is a protease known to be an important enzyme involved in the cellular pathways. BACE2 has been shown to interact with GGA1 and GGA2. It is th...
TMPY-05750 Human coronavirus (HCoV-OC43) Spike S1 Protein (His) HCoV-OC43 HEK293
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-05670 Human coronavirus (HCoV-NL63) Spike S1 Protein (His) HCoV-NL63 HEK293
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-05674 Human coronavirus (HCoV-NL63) Spike Protein (S1+S2 ECD, His) HCoV-NL63 Baculovirus-Insect Cells
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-05675 Human coronavirus (HCoV-229E) Spike Protein (S1+S2 ECD, His) HCoV-229E Baculovirus-Insect Cells
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-03574 MERS-CoV Spike/S1 Protein (aa 1-725, His) MERS-CoV HEK293
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-05671 Human coronavirus (HCoV-229E) Spike S1 Protein (His) HCoV-229E HEK293
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-03512 MERS-CoV Spike/S2 Protein (aa 726-1296, His) MERS-CoV Baculovirus-Insect Cells
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-05676 Human coronavirus HKU1 (isolate N5) (HCoV-HKU1) Spike Protein (S1+S2 ECD, His) HCoV-HKU1 Baculovirus-Insect Cells
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-02429 Human coronavirus HKU1 (isolate N1) (HCoV-HKU1) Spike S1 Protein (His) HCoV-HKU1 HEK293
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-00402 MERS-CoV Spike/RBD Protein fragment (aa 367-606, His) MERS-CoV Baculovirus-Insect Cells
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-03661 MERS-CoV Spike Protein (S1+S2 ECD, aa 1-1297, His) MERS-CoV Baculovirus-Insect Cells
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-06013 Human coronavirus (HCoV-OC43) Spike S2 Protein (His) HCoV-OC43 Baculovirus-Insect Cells
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-05677 Human coronavirus (HCoV-OC43) Spike Protein (S1+S2 ECD, His) HCoV-OC43 Baculovirus-Insect Cells
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPY-05679 SARS-CoV-2 Spike RBD Protein (hFc) SARS-CoV-2 HEK293
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;...
TMPK-00435 SARS-COV-2 Spike S Trimer Protein (D614G, His & Avi) SARS-CoV-2 HEK293
The SARS-CoV-2 spike (S) protein variant D614G supplanted the ancestral virus worldwide, reaching near fixation in a matter of months. Recently, that D614G was been found more infectious than the ancestral form on human ...
TMPK-00442 SARS-COV-2 (Omicron B.1.1.529) Spike S Trimer Protein (His & Avi), Biotinylated SARS-CoV-2 HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00441 SARS-COV-2 Spike S Trimer Protein (His & Avi), Biotinylated SARS-CoV-2 HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00440 SARS-COV-2 Spike S1 Protein (His & Avi), Biotinylated SARS-CoV-2 HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00432 SARS-COV-2 Spike S1 Protein (hFc & Avi) SARS-CoV-2 HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00437 SARS-COV-2 Spike RBD Protein (His & Avi) SARS-CoV-2 HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00912 SARS Spike RBD Protein (His & Avi), Biotinylated SARS HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00910 SARS Spike S1 Protein (His & Avi) SARS HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00909 SARS Spike S1 Protein (hFc & Avi), Biotinylated SARS HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00438 SARS-COV-2 Spike S Trimer Protein (His & Avi) SARS-CoV-2 HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00443 SARS-COV-2 (Omicron B.1.1.529) Spike S1 Protein (His & Avi), Biotinylated SARS-CoV-2 HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00911 SARS Spike RBD Protein (His & Avi) SARS HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00444 SARS-COV-2 Spike S1 NTD Protein (His & Flag) SARS-CoV-2 HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00434 SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated SARS-CoV-2 HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00908 SARS Spike S1 Protein (hFc & Avi) SARS HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00433 SARS-COV-2 Spike S1 Protein (hFc & Avi), Biotinylated SARS-CoV-2 HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00439 SARS-COV-2 Spike RBD Protein (His & Avi), Biotinylated SARS-CoV-2 HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
TMPK-00913 SARS Spike S1 Protein (His & Avi), Biotinylated SARS HEK293
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k...
------------------------ More ------------------------
ACE2/ACEH Protein, Human, Recombinant (His & Avi)
TMPK-00383
Species: Human
Expression System: HEK293
ACE2/ACEH Protein, Cynomolgus, Recombinant (His & Avi), Biotinylated
TMPK-00552
Species: Cynomolgus
Expression System: HEK293
ACE2/ACEH Protein, Cynomolgus, Recombinant (His & Avi)
TMPK-00551
Species: Cynomolgus
Expression System: HEK293
ACE2/ACEH Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPK-00382
Species: Human
Expression System: HEK293
ACE2/ACEH Protein, Human, Recombinant (HEK293, His & Avi), Biotinylated
TMPJ-00386
Species: Human
Expression System: Human Cells
ACE2/ACEH Protein, Rhesus, Recombinant (His)
TMPY-03830
Species: Rhesus
Expression System: HEK293
ACE2/ACEH Protein, Rhesus, Recombinant (hFc)
TMPY-03561
Species: Rhesus
Expression System: HEK293
ACE2 Protein, Paguma larvata, Recombinant (hFc)
TMPH-03081
Species: Paguma larvata
Expression System: HEK293
ACE2/ACEH Protein, Human, Recombinant (His)
TMPY-05266
Species: Human
Expression System: HEK293
ACE2/ACEH Protein, Human, Recombinant (hFc)
TMPY-00655
Species: Human
Expression System: HEK293
ACE2/ACEH Protein, Rat, Recombinant (His)
TMPY-02207
Species: Rat
Expression System: HEK293
ACE2/ACEH Protein, Human, Recombinant (mFc)
TMPY-04312
Species: Human
Expression System: HEK293
ACE2/ACEH Protein, Mouse, Recombinant (His)
TMPY-01838
Species: Mouse
Expression System: HEK293
ACE2/ACEH Protein, Mouse, Recombinant (His & hFc)
TMPY-01839
Species: Mouse
Expression System: HEK293
ACE2/ACEH Protein, Human, Recombinant (His), Biotinylated
TMPY-05696
Species: Human
Expression System: HEK293
ACE2/ACEH Protein, Human, Recombinant (hFc), Biotinylated
TMPY-06334
Species: Human
Expression System: HEK293
ACE2/ACEH Protein, Human, Recombinant (His & Avi), Biotinylated
TMPY-05725
Species: Human
Expression System: Baculovirus-Insect Cells
BACE2 Protein, Mouse, Recombinant (His)
TMPY-03065
Species: Mouse
Expression System: HEK293
Human coronavirus (HCoV-OC43) Spike S1 Protein (His)
TMPY-05750
Species: HCoV-OC43
Expression System: HEK293
Human coronavirus (HCoV-NL63) Spike S1 Protein (His)
TMPY-05670
Species: HCoV-NL63
Expression System: HEK293
Human coronavirus (HCoV-NL63) Spike Protein (S1+S2 ECD, His)
TMPY-05674
Species: HCoV-NL63
Expression System: Baculovirus-Insect Cells
Human coronavirus (HCoV-229E) Spike Protein (S1+S2 ECD, His)
TMPY-05675
Species: HCoV-229E
Expression System: Baculovirus-Insect Cells
MERS-CoV Spike/S1 Protein (aa 1-725, His)
TMPY-03574
Species: MERS-CoV
Expression System: HEK293
Human coronavirus (HCoV-229E) Spike S1 Protein (His)
TMPY-05671
Species: HCoV-229E
Expression System: HEK293
MERS-CoV Spike/S2 Protein (aa 726-1296, His)
TMPY-03512
Species: MERS-CoV
Expression System: Baculovirus-Insect Cells
Human coronavirus HKU1 (isolate N5) (HCoV-HKU1) Spike Protein (S1+S2 ECD, His)
TMPY-05676
Species: HCoV-HKU1
Expression System: Baculovirus-Insect Cells
Human coronavirus HKU1 (isolate N1) (HCoV-HKU1) Spike S1 Protein (His)
TMPY-02429
Species: HCoV-HKU1
Expression System: HEK293
MERS-CoV Spike/RBD Protein fragment (aa 367-606, His)
TMPY-00402
Species: MERS-CoV
Expression System: Baculovirus-Insect Cells
MERS-CoV Spike Protein (S1+S2 ECD, aa 1-1297, His)
TMPY-03661
Species: MERS-CoV
Expression System: Baculovirus-Insect Cells
Human coronavirus (HCoV-OC43) Spike S2 Protein (His)
TMPY-06013
Species: HCoV-OC43
Expression System: Baculovirus-Insect Cells
Human coronavirus (HCoV-OC43) Spike Protein (S1+S2 ECD, His)
TMPY-05677
Species: HCoV-OC43
Expression System: Baculovirus-Insect Cells
SARS-CoV-2 Spike RBD Protein (hFc)
TMPY-05679
Species: SARS-CoV-2
Expression System: HEK293
SARS-COV-2 Spike S Trimer Protein (D614G, His & Avi)
TMPK-00435
Species: SARS-CoV-2
Expression System: HEK293
SARS-COV-2 (Omicron B.1.1.529) Spike S Trimer Protein (His & Avi), Biotinylated
TMPK-00442
Species: SARS-CoV-2
Expression System: HEK293
SARS-COV-2 Spike S Trimer Protein (His & Avi), Biotinylated
TMPK-00441
Species: SARS-CoV-2
Expression System: HEK293
SARS-COV-2 Spike S1 Protein (His & Avi), Biotinylated
TMPK-00440
Species: SARS-CoV-2
Expression System: HEK293
SARS-COV-2 Spike S1 Protein (hFc & Avi)
TMPK-00432
Species: SARS-CoV-2
Expression System: HEK293
SARS-COV-2 Spike RBD Protein (His & Avi)
TMPK-00437
Species: SARS-CoV-2
Expression System: HEK293
SARS Spike RBD Protein (His & Avi), Biotinylated
TMPK-00912
Species: SARS
Expression System: HEK293
SARS Spike S1 Protein (His & Avi)
TMPK-00910
Species: SARS
Expression System: HEK293
SARS Spike S1 Protein (hFc & Avi), Biotinylated
TMPK-00909
Species: SARS
Expression System: HEK293
SARS-COV-2 Spike S Trimer Protein (His & Avi)
TMPK-00438
Species: SARS-CoV-2
Expression System: HEK293
SARS-COV-2 (Omicron B.1.1.529) Spike S1 Protein (His & Avi), Biotinylated
TMPK-00443
Species: SARS-CoV-2
Expression System: HEK293
SARS Spike RBD Protein (His & Avi)
TMPK-00911
Species: SARS
Expression System: HEK293
SARS-COV-2 Spike S1 NTD Protein (His & Flag)
TMPK-00444
Species: SARS-CoV-2
Expression System: HEK293
SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated
TMPK-00434
Species: SARS-CoV-2
Expression System: HEK293
SARS Spike S1 Protein (hFc & Avi)
TMPK-00908
Species: SARS
Expression System: HEK293
SARS-COV-2 Spike S1 Protein (hFc & Avi), Biotinylated
TMPK-00433
Species: SARS-CoV-2
Expression System: HEK293
SARS-COV-2 Spike RBD Protein (His & Avi), Biotinylated
TMPK-00439
Species: SARS-CoV-2
Expression System: HEK293
SARS Spike S1 Protein (His & Avi), Biotinylated
TMPK-00913
Species: SARS
Expression System: HEK293
--------- More ---------
Cat No. Product Name
L1710 Anti-COVID-19 Compound Library

1160 compounds
A unique collection of 1160 compounds with confirmed anti-SARS-CoV-2 activity or potential activity and part of them are broad-spectrum antiviral agents；

Libraries

Anti-COVID-19 Compound Library
L1710
Compounds: 1160
CORPORATE
About Us Careers Privacy Notice Events & News Terms & Conditions
SUPPORT
Contact Us Worldwide Distributors Quality Control Technical Support
RESOURCE
Product Catalog Product Citations Signaling Pathways Solution Calculators
FOLLOW OUR
Social Network
Newsletter Subscription
Subscribe to receive our lastest product updates and special offers!
Corporate
Support
Resource
Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
TargetMol
Copyright © 2015-2024 TargetMol Chemicals Inc. All rights reserved.