pps

PPS Silent Surfactant is a cleavable detergent used in biochemistry, and especially in proteomics, to enhance protein denaturation and solubility.

HEPPS exhibits inhibitory activity against the amyloid-beta precursor protein, reducing Aβ aggregation burden and improving neuronal autophagy flux, thereby alleviating neuronal apoptosis and traumatic brain injury (TBI) in mice. It can be used for research into Alzheimer's disease and neurological disorders.

HEPPSO is an amphoteric ion buffer with a pH range of 7.1-8.5, exhibiting strong binding affinity for copper(II) ions, and is widely used in biochemical experiments.

FeTPPS, a decomposition catalyst for 5,10,15,20-tetrakis(4-sulfonatophenyl) porphyrin iron(III) chloride peroxynitrite, exhibits marked neuroprotective effects in experimental spinal cord injury models. It reduces cerebral tissue inflammation and damage, inhibits nitric oxide production and apoptosis, and may be employed in traumatic brain injury (TBI) research.

KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia[1]. [1]. US20150315260 A1

HGGPPS-IN-1 is an analogue of C-2-substituted thienopyrimidine-based bisphosphonates (C2-ThP-BPs). HGGPPS-IN-1 has an effective inhibitory effect on human geranyl geranyl pyrophosphate synthase (hGGPPS). HGGPPS-IN-1 can selectively induce apoptosis of multiple myeloma (MM) cells. HGGPPS-IN-1 showed anti-myeloma activity in vivo.

hGGPPS-IN-2 is an analogue of C-2 substituted thienopyrimidinyl bisphosphonates (C2-ThP-BPs) and is a potent inhibitor of human geranylgeranyl pyrophosphate synthase (hGGPPS). hGGPPS-IN-2 targets multiple myeloma (MM) cells, induces selective apoptosis, and shows anti-myeloma effects in vivo. It has shown anti-myeloma effects in vivo.

[1,3-Bis(2,6-Diisopropylphenyl)imidazol-2-ylidene](3-chloropyridyl)palladium(II) dichloride is a useful organic compound for research related to life sciences and the catalog number is T66162.

Compound 13h (hGGPPS-IN-3) is a potent inhibitor of human geranylgeranyl pyrophosphate synthase (hGGPPS), characterized as a C-2-substituted thienopyrimidine-based bisphosphonate analogue (C2-ThP-BPs). It selectively induces apoptosis in multiple myeloma (MM) cells and demonstrates antimyeloma activity in vivo [1].

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

FPPS-IN-2 (compound 4a) is an effective orally active HFPPS inhibitor with an IC50 value of 1.108 µM, showing potential for use in osteoporosis research.

SADDNIKTPAE(Arg-13C6,15N4)LLGPLPPSADDNLKT (TFA) is an isotopically labeled version of SADDNIKTPAE-LLGPLPPSADDNLKT (TFA), incorporating 13C and 15N isotopes, and presented as a trifluoroacetate salt.

PIPPS is a buffering agent commonly used in biological and biochemical research to maintain the pH of solutions.

HEPPSO (sodium) is a biological buffering agent, suitable for use as a biomaterial or organic compound in life science research.

TPPS dihydrochloride is a biochemical reagent that can be used as a biomaterial for life science related research and as a sulfonylation reagent for organic synthesis and drug discovery.

Okadaic acid is a potent polyether marine toxin that primarily accumulates in the digestive glands of marine mollusks. It is a highly effective and selective inhibitor of protein phosphatases (PPs). By inhibiting these phosphatases, okadaic acid increases the phosphorylation levels of various proteins, acts as a tumor promoter, and induces tau protein phosphorylation. It can be used to establish models of Alzheimer’s disease and skin cancer.

Okadaic acid ammonium salt is a marine toxin that acts as an inhibitor of protein phosphatases (PP), with the highest affinity for PP2A (IC50 = 0.1–0.3 nM), while also inhibiting PP1, PP3, PP4, and PP5, but not PP2C. By increasing the phosphorylation of various proteins, it functions as a tumor promoter and induces tau protein phosphorylation, commonly used to establish Alzheimer's disease models.