Search Result

Search Results for " mn "

Targets

MNK Stemness kinase Others PARP Wnt/beta-catenin

108

Compounds

105

Natural Products

Recombinant Proteins

Cat No.	Product Name	Synonyms	Targets
T3168	MN-64	MN64	Others , PARP , Wnt/beta-catenin
	MN-64 is a tankyrases inhibitor, showed 6 nM potency against tankyrase 1, isoenzyme selectivity, and Wnt signaling inhibition.		Others , PARP , Wnt/beta-catenin
T38164	MnTBAP chloride	Mn(III)TBAP
	MnTBAP chloride (Mn(III)TBAP) is a cell-permeable superoxide dismutase (SOD) mimetic and peroxynitrite scavenger that reduces the doubling time of SOD-E. coli by a factor of 2. MnTBAP chloride exhibits anti-inflammatory ...
T22271	BFMO (biogenic Fe-Mn oxides)	N,N'-Difurfuryloxamide	Others
	BFMO (biogenic Fe-Mn oxides) (N,N'-Difurfuryloxamide) could eliminate or decrease Fe(II), Mn(II), and As(III&V) species simultaneously. Moreover, BFMO (biogenic Fe-Mn oxides) can be used for As removal from water contain...		Others
T33458	MN-05	MN 05,MN05
	MN-05 is a neuroprotective and vasodilator for neurodegenerative diseases.
T15647	Tipelukast	MN 001,KCA 757	Leukotriene Receptor
	Tipelukast (KCA 757) is a novel orally available leukotriene receptor antagonist with anti-inflammatory activity that reduces fibrosis and down-regulates TIMP-1, type 1 collagen.Tipelukast is used in the study of asthma.		Leukotriene Receptor
T26760	Bedoradrine sulfate	KUR1246,MN 221 sulfate,KUR1246 sulfate,MN221 sulfate,KUR 1246 sulfate,MN-221 sulfate,KUR 1246,KUR-1246 sulfate,MN-221,MN 221,MN221,KUR-1246	Adrenergic Receptor
	Bedoradrine sulfate (MN-221 sulfate) is a super-selective beta2 agonist for the treatment of asthma exacerbations and chronic obstructive pulmonary disease.		Adrenergic Receptor
T35966	Mn(III)TMPyP
	Mn(III)TMPyP is a manganese-porphyrin which acts as a superoxide dismutase (SOD) mimetic and peroxynitrite decomposition catalyst. SOD mimetics described to date are unstable and are capable of catalyzing undesired side-...
T2137	Ibudilast	AV-411,KC-404,MN-166	PDE
	Ibudilast (MN-166)(KC-404;AV-411;MN-166) is a relatively nonselective phosphodiesterase inhibitor. It is approved for use as an anti-inflammatory in Japan.		PDE
T39603	Mn(II) protoporphyrin IX
	Mn(II) protoporphyrin IX is a potent intravenous paramagnetic magnetic resonance contrast agent, known for its strong paramagnetic properties.
T28270	Osemozotan HCl	Osemozotan hydrochloride,MN-305,MCI-242,MKC-242,MKC242,MCI242
	Osemozotan is a 5-HT1A receptor agonist potentially for the treatment of generalized anxiety disorder.
T76537	GP120, HIV-1 MN
	GP120, HIV-1 MN, a peptide, is utilized in researching HIV infection [1] [2].
T12085	MN58b		Apoptosis , AChR
	MN58b is a selective inhibitor of choline kinase α (CHKα).		Apoptosis , AChR
T83663	Mn(III) Protoporphyrin IX Chloride	Manganese(III) Protoporphyrin IX Chloride
	Mn(III) protoporphyrin IX chloride is a metalloporphyrin that, at a concentration of 10 µM, promotes mRNA expression of δ-aminolevulinate synthase and heme oxygenase (HO) in chick embryo liver cells, enzymes crucial for ...
T23751	AQX-MN115
	AQX-MN115 is an SH2- containing inositol 5- phosphatase modulator.
T68708	Denibulin HCl
	Denibulin (MN-029) is a novel vascular-disrupting agent that reversibly inhibits microtubule assembly, resulting in disruption of the cytoskeleton of tumor vascular endothelial cells. The results of preclinical study dem...
T70046	Rovadicitinib
	Rovadicitinib is a Janus kinase inhibitor, also known as a JAK inhibitor. Rovadicitinib has potential for anti-inflammatory applications.
T70927	UCD74A HCl
	UCD74A HCl is a cell impermeant homolog of UCD38B, inhibitor of uPA (urokinase plasminogen activator).
T7714	Temocapil		Tyrosinase
	Temocapril is an inhibitor of tyrosine kinase.		Tyrosinase
T6698	Temocapril hydrochloride	CS-622 HCl,Acecol,Temocapril HCl,CS-622	RAAS
	Temocapril hydrochloride (CS-622 HCl), the hydrochloride of Temocapril, is a long-acting ACE inhibitor used for the therapy of hypertension.		RAAS
T9945	MNK8	3-methyl-6-(naphthalen-1-yl)pyrimidine-2,4(1H,3H)-dione	STAT
	MNK8 (3-methyl-6-(naphthalen-1-yl)pyrimidine-2,4(1H,3H)-dione) is a potent STAT3 inhibitor that reduces the ability of STAT3 to bind to DNA and also has a good growth inhibition effect on liver cancer cells [1].		STAT
T9249	ITMN4077		Antiviral
	ITMN4077 has antiviral activity against Hepatitis C virus infected in human HuH7 cells assessed as inhibition of HCV subgenomic replicon replication with an EC50 of 2.131μM.		Antiviral
T9341	Bemnifosbuvir	AT-511	Others , HCV Protease , SARS-CoV
	Bemnifosbuvir (AT-511) is a novel phosphoramidate prodrug of 2'-fluoro-2'-C-methylguanosine-5'-monophosphate that has potent in vitro activity against HCV.		Others , HCV Protease , SARS-CoV
T21935L	AMN082 free base	AMN082	GluR
	AMN082 free base is a metabotropic glutamate receptor 7 allosteric agonist.		GluR
T12935	SMN-C3	MV8T2MCK57	DNA/RNA Synthesis
	SMN-C3 (MV8T2MCK57) is an orally active modulator of SMN2 splicing, and has the potential to treat spinal muscular atrophy (SMA).		DNA/RNA Synthesis
T23010	MNI 137		Others , GluR
	MNI 137 is a negative allosteric modulator of mGlu2. MNI 137 inhibits glutamate-induced calcium mobilization with IC50s of 8.3 and 12.6 nM for human and rat.		Others , GluR
T9331	Bemnifosbuvir hemisulfate	AT-527	HCV Protease , SARS-CoV
	Bemnifosbuvir hemisulfate (AT-527) is a potent inhibitor of HCV virus replication.		HCV Protease , SARS-CoV
T9603	MNITMT
	MNITMT is a potent immunosuppressive agent without bone marrow toxicity [1].
T3643	HMN-176		PLK
	HMN-176 is a stilbene derivative which inhibits mitosis, interfering with polo-like kinase-1 (plk1).		PLK
T4311	HAMNO	NSC111847	DNA/RNA Synthesis
	HAMNO (NSC-111847) is a protein interaction inhibitor of replication protein A (RPA).		DNA/RNA Synthesis
T8637	DMNB	6-Nitroveratraldehyde	DNA-PK
	DMNB (6-Nitroveratraldehyde) is DNA-dependent protein kinase (DNA-PK) inhibitor with IC50 of 15 μM, an enzyme involved in the non-homologous end-joining (NHEJ) pathway of double-stranded DNA break (DSB) repair in human c...		DNA-PK
T4025	HMN-154	HMN154	Others
	HMN-154 is a novel benzenesulfonamide anticancer compound. It is able to interact with NF-YB and interrupt the binding of NF-Y heterotrimer to DNA.		Others
T6594	MNS		Syk , Src , p97
	MNS is a tyrosine kinases inhibitor, inhibits Syk, Src, p97 with IC50 of 2.5 μM, 29.3 μM and 1.7 μM, respectively.		Syk , Src , p97
T5426	DMNQ		Reactive Oxygen Species , ROS
	DMNQ is a 1,4-naphthoquinone that acts as a redox-cycling agent, typically increasing intracellular superoxide and hydrogen peroxide formation.DMNQ increases ROS generation		Reactive Oxygen Species , ROS
T13171	TMN355		Others
	TMN355 is a potent chemical inhibitor of cyclophilin A and reduces foam cell formation and cytokine secretion,and is used for atherosclerosis.		Others
T2438	HMN-214	IVX-214,HMN214	PLK
	HMN-214 (IVX-214) is a potent PLK1 inhibitor with an average IC50 of 0.12 μM.		PLK
T73475	SMN-C2		DNA/RNA Synthesis
	SMN-C2 is a selective regulator of SMN2 gene splicing, a risdiplam analogue, a selective RNA-binding ligand that regulates pre-mRNA splicing and acts by binding to SMN2 pre-mRNA.SMN-C2 has the potential to be used in the...		DNA/RNA Synthesis
T74998	LmNADK1-IN-1
	LmNADK1-IN-1 (compound MC1) is an inhibitor of nicotinamide adenine dinucleotide kinases ( NADK1 ) from L. monocytogenes with a K i value of 54 nM. LmNADK1-IN-1 can be used for the research of bacterial infection [1] .
T81776	MN551
	MN551 is a potent inhibitor that targets the cysteine-directed electrophilic covalent activity essential for the function of SOCS2 within its CRL5 complex. This compound also acts as an E3 ligase mediator, facilitating P...
T69794	HMN-1180
	HMN-1180 is a small molecule inhibitor of neuronal nitric oxide synthase.
T27190	DMNPE	D-Luciferin 1-(4,5-dimethoxy-2- nitrophenyl) ethyl ester;,D-Luciferin 1-(4,5-dimethoxy-2- nitrophenyl) ethyl ester
	DMNPE (D-Luciferin 1-(4,5-dimethoxy-2- nitrophenyl) ethyl ester) is a chemical agent that forms stable complexes with DNA molecules, effectively "caging" or blocking the biological activity of DNA. Once inside the cell, ...
T126068	Quercetin 3-(2-xylosylrhamnoside)
	Quercetin 3-(2-xylosylrhamnoside) is a useful organic compound for research related to life sciences. The catalog number is T126068 and the CAS number is 130866-55-6.
T37695	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
	NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions.
T40092	MNK/PIM-IN-1
	MNK/PIM-IN-1 is a novel dual inhibitor targeting both MNK and PIM pathways, characterized by its favorable pharmacokinetic profile.
T23013	MNI-caged-L-glutamate		Others
	rapidly and efficiently releases glutamate		Others
T72752	MNK inhibitor 9
	MNK Inhibitor 9 is a potent, selective inhibitor of MNK1/2, demonstrating IC50 values of 0.003 µM for both MNK1 and MNK2. It exhibits good cell permeability, making it suitable for tumor-related research.
T29450	5-Deaza-fmn	Deazafmn,5-Deazariboflavin-5'-phosphate
	5-Deaza-fmn is a biochemical.
T9471	Imnopitant
	Imnopitant is an antagonist of the NK1 receptor [1].
T33460	MNI-136	MNI 136
	MNI-136 is a bioactive chemical.
T16416	Oxamniquine		Others
	Oxamniquine is an effective compound for the treatment of schistosomiasis.		Others
T23012	MNI caged kainic acid		Others
	Generates large inward currents at resting membrane potential		Others

Compounds

MN-64

T3168

Synonym: MN64

Target: Others, PARP, Wnt/beta-catenin

BFMO (biogenic Fe-Mn oxides)

T22271

Synonym: N,N'-Difurfuryloxamide

Synonym: MN 001,KCA 757

Target: Leukotriene Receptor

Bedoradrine sulfate

T26760

Synonym: KUR1246,MN 221 sulfate,KUR1246 sulfate,MN221 sulfate,KUR 1246 sulfate,MN-221 sulfate,KUR 1246,KUR-1246 sulfate,MN-221,MN 221,MN221,KUR-1246

Target: Adrenergic Receptor

Synonym: AV-411,KC-404,MN-166

Target: PDE

Mn(II) protoporphyrin IX

Synonym: Osemozotan hydrochloride,MN-305,MCI-242,MKC-242,MKC242,MCI242

Target: Apoptosis, AChR

Mn(III) Protoporphyrin IX Chloride

T83663

Synonym: Manganese(III) Protoporphyrin IX Chloride

Temocapril hydrochloride

T6698

Synonym: CS-622 HCl,Acecol,Temocapril HCl,CS-622

Target: RAAS

MNK8

T9945

Synonym: 3-methyl-6-(naphthalen-1-yl)pyrimidine-2,4(1H,3H)-dione

Target: Others, HCV Protease, SARS-CoV

Target: DNA/RNA Synthesis

Bemnifosbuvir hemisulfate

T9331

Synonym: AT-527

Target: HCV Protease, SARS-CoV

Target: DNA/RNA Synthesis

DMNB

T8637

Synonym: 6-Nitroveratraldehyde

Target: Syk, Src, p97

DMNQ

T5426

Synonym:

Target: Reactive Oxygen Species, ROS

Synonym: IVX-214,HMN214

Target: DNA/RNA Synthesis

Synonym: D-Luciferin 1-(4,5-dimethoxy-2- nitrophenyl) ethyl ester;,D-Luciferin 1-(4,5-dimethoxy-2- nitrophenyl) ethyl ester

Target:

Quercetin 3-(2-xylosylrhamnoside)

T126068

Synonym:

Target:

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

MNI-caged-L-glutamate

Synonym: Deazafmn,5-Deazariboflavin-5'-phosphate

MNI caged kainic acid

T23012

Synonym:

Target: Others

Cat No.	Product Name	Synonyms	Targets
TQ0172	2''-O-Rhamnosylicariside II		Others
	2''-O-Rhamnosylicariside II might be beneficial for improving postmenopausal osteoporosis. It shows potent antioxidant activity, with IC50 values of 11.5 ug/mL and 90.5 uM.		Others
TN2151	Rhamnocitrin		Others
	Rhamnocitrin can enhance the immune function, improve the formation of spleen cells of mice serum hemolysin of chicken red blood cell immune.		Others
T2928	α-L-Rhamnose monohydrate	L-Rhamnose monohydrate,6-deoxy-L-mannose monohydrate	Others
	α-L-Rhamnose monohydrate (6-deoxy-L-mannose monohydrate) is a component of bacterial polysaccharides where it plays an important role in pathogenicity.		Others
T2836	Isorhamnetin	3-methylquercetin,3'-Methylquercetin,Isorhamnetol,3'-Methoxyquercetin	MEK , PI3K , Endogenous Metabolite
	Isorhamnetin (3-methylquercetin) is the methylated metabolite of quercetin. Quercetin is an important dietary flavonoid with in vitro antioxidant activity. Isorhamnetin prevents endothelial cell injuries from oxidized LD...		MEK , PI3K , Endogenous Metabolite
T5S0089	Kaempferol-3-O-glucorhamnoside	Kaempferol 3-glucorhamnoside	Antioxidant , p38 MAPK , NF-κB
	Kaempferol-3-O-glucorhamnoside (Kaempferol 3-glucorhamnoside), a flavonoid derived from plant Thesium chinense Turcz, inhibits inflammatory responses via MAPK and NF-κB pathways in vitro and in vivo[1]. Kaempferol-3-O-gl...		Antioxidant , p38 MAPK , NF-κB
TN6719	Kaempferol-3-O-β-D-glucosyl(1-2)rhamnoside		Others
	Kaempferol-3-O-β-D-glucosyl(1-2)rhamnoside is a natural peoduct isolated from Arabian jasmine		Others
TN1720	Gymnoside III		Others
	Gymnoside III is a natural product from Gymnadenia conopsea.		Others
T3S1250	Ophiogenin 3-O-α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside	Ophiogenin-3-O-alpha-L-rhaMnopyranosyl-(1->2)-beta-D-glucopyranoside	Others
	Ophiogenin 3-O-α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside (Ophiogenin-3-O-alpha-L-rhaMnopyranosyl-(1->2)-beta-D-glucopyranoside) is a natural product, and has good pharmacological effects on the cardiovascular system.		Others
T25327	Didemnin B	NSC 325319,NSC325319,NSC-325319,Didemnin-B	Antiviral
	Didemnin B (Didemnin-B) is a depsipeptide extracted from the marine tunicate Trididemnin cyanophorum that has antiviral and antitumor activity.		Antiviral
TN2260	Taxifolin 7-O-rhamnoside	Taxifolin 7-O-α-L-rhamnoside	Others
	Taxifolin 7-O-rhamnoside (Taxifolin 7-O-α-L-rhamnoside) is a natural product from Hypericum japonicum.		Others
TN6776	β-D-glucopyranosyl-[α-L-rhamnopyranosyl-(1→3)-βD-glucuronopyranosyl-(1→3)]-3β-hydroxyolean-12-ene28-oate	Cyaonoside B	Others
	Cyaonoside B is isolated from S. simplex as a saponin and has a glucuronic acid attached to carbon C-3.		Others
TN1419	Rhamnetin	beta-Rhamnocitrin	Others , Phospholipase
	Rhamnetin (beta-Rhamnocitrin), a quercetin derivative found in Coriandrum sativum, has antioxidant and anti-inflammatory activities. Rhamnetin inhibits secretory phospholipase A2.		Others , Phospholipase
T3671	Vitexin-2"-O-rhamnoside	2''-O-Rhamnosylvitexin,Vitexin-2-O-rhaMnoside,Vitexin-2''-O-rhamnoside,Apigenin-8-C-glucoside	Others
	Vitexin-2"-O-rhamnoside (Apigenin-8-C-glucoside) is a compound contributes to the protection against H O -mediated oxidative stress damage.		Others
T5743	Gymnemagenin		Liver X Receptor
	Gymnemagenin is a potent and selective antagonist for the β isoform of LXR, it has antihyperglycemic activity.		Liver X Receptor
T5S1988	Isorhamnetin-3-O-glucoside	Isorhamnetin-3-O-beta-D-Glucoside	Others
	Isorhamnetin-3-O-glucoside (Isorhamnetin-3-O-beta-D-Glucoside) inhibits the activity of alpha-glucosidase from rat intestine; it exhibits a potent rat lens aldose reductase (RLAR) inhibition in vitro, its IC(50) being 1....		Others
T5S1526	Apigenin-7-O-(2G-rhamnosyl)gentiobioside	Apigenin 7-O-(2G-rhamnosyl)gentiobioside,Apigenin 7-(2-Rhamnosylgentiobioside)	Others
	Apigenin-7-O-(2G-rhamnosyl)gentiobioside is a flavonoid glycoside compound extracted from Lonicera gracilipes var. glandulosa.		Others
TN2125	Quercetin 3-O-β-D-(6''-p-coumaroyl)glucopyranosyl(1→2)-α-L-rhamnopyranoside	Quercetin 3-O-beta-(6''-p-coumaroyl)glucopyranosyl(1->2)-alpha-L-rhamnopyranoside	Antioxidant
	Quercetin 3-O-β-D-(6''-p-coumaroyl)glucopyranosyl(1→2)-α-L-rhamnopyranoside (Quercetin 3-O-beta-(6''-p-coumaroyl)glucopyranosyl(1->2)-alpha-L-rhamnopyranoside) is a compound extracted from the leaves of Ginkgo biloba. Qu...		Antioxidant
T3799	Isorhamnetin-3-O-neohespeidoside	Isorhamnetin 3-O-neohesperidin,Isorhamnetin 3-O-neohesperoside,Calendoflavoside	Antioxidant
	Isorhamnetin-3-O-neohespeidoside (Calendoflavoside) is a flavonol glycoside extract used as an anti-oxidant.		Antioxidant
T6559	Rhamnose monohydrate	L-(+)-Rhamnose Monohydrate	Others
	Rhamnose monohydrate (L-(+)-Rhamnose Monohydrate) is a naturally-occurring deoxy sugar that is found primarily in plants and some bacteria.		Others
T5120	Rhamnose	6-Deoxyhexopyranose,6-Deoxy-L-mannose,alpha-L-Rhamnose	Calcium Channel , Endogenous Metabolite
	Addition of the Rhamnose (6-Deoxy-L-mannose)-rich polysaccharide, RROP-1, to normal human dermal fibroblasts (NHDFs) and human endothelial cells produced a dose-dependent stimulation of the calcium-signaling pathway, ind...		Calcium Channel , Endogenous Metabolite
TN4325	Isorhamnetin 3-robinobioside		Antioxidant
	Isorhamnetin 3-robinobioside is extracted from Nitraria retusa leaves wtih antioxidant and antigenotoxic activities.		Antioxidant
TN7213	Ellagic acid 3-O-α-L-rhamnopyranoside		Others
	Ellagic acid 3-O-α-L-rhamnopyranoside is a natural product found in the tuberous roots of Potentilla anserina.		Others
TN7112	(25R)-3β,17α-dihydroxy-5α- spirostan-6-one3-O-α-L- rhamnopyranosyl-(1→2)-β- D-glucopyranoside		Others
	(25R)-3β,17α-dihydroxy-5α- spirostan-6-one3-O-α-L- rhamnopyranosyl-(1→2)-β- D-glucopyranoside is a natural product isolated from the bulbs of Lilium brownii var. viridulum.		Others
TN6734	Quercetin-3-O-D-glucosyl]-(1-2)-L-rhamnoside	Quercetin 3-O-beta-D-glucosyl-(1->2)-rhamnoside	Others
	Quercetin-3-O-D-glucosyl]-(1-2)-L-rhamnoside (Quercetin 3-O-beta-D-glucosyl-(1->2)-rhamnoside) is main antioxidant of Shuxuening, an herbal medicines injection.		Others
T4242	Catechin 3-rhamnoside		Others
	Catechin 3-rhamnoside has antioxidant activity.		Others
TN1791	Isorhamnetin 3,7-di-O-β-D-glucopyranoside	Isorhamnetin 3,7-O-diglucoside	Others
	Isorhamnetin 3,7-O-diglucoside may have antioxidant activity.		Others
TN5886	Thamnosmonin
	Thamnosmonin is a natural product from Citrus sinensis.
TN1205	2,3-Didehydrosomnifericin		Others
	2,3-Didehydrosomnifericin is a natural product		Others
TN3044	4-Hydroxymethylphenol 1-O-rhamnoside		Others
	4-Hydroxymethylphenol 1-O-rhamnoside is a natural product for research related to life sciences. The catalog number is TN3044 and the CAS number is 478314-67-9.		Others
TN5525	Orientin 2''-O-rhamnoside	2''-O-Rhamnosylorientin,Luteolin 8-C-neohesperidoside
	Orientin 2''-O-rhamnoside is a natural product for research related to life sciences. The catalog number is TN5525 and the CAS number is 81398-30-3.
T83568	(25R)-Ruscogenin-3-yl α-L-rhamnopyranosyl-(1→2)-[β-D-xylopyranosyl-(1→4)]-β-D-glucopyranoside
	Compound 1, (25R)-Ruscogenin-3-yl α-L-rhamnopyranosyl-(1→2)-[β-D-xylopyranosyl-(1→4)]-β-D-glucopyranoside, is a steroidal saponin that can be isolated from the roots of Ophiopogon japonicus [1].
T83209	Acacetin 7-O-β-D-glucuronopyranosyl-(1→2)[α-L-rhamnopyranosyl-(1→6)]-β-D-glucopyranoside
	Acacetin 7-O-β-D-glucuronopyranosyl-(1→2)[α-L-rhamnopyranosyl-(1→6)]-β-D-glucopyranoside, also known as compound 8, is a flavonoid glycoside isolated from the leaf extract of the black locust (Leguminosae)[1].
T82549	Diosgenin-3-O-rhamnosyl(1→2)[glucosyl(1→6)]glucoside
	Diosgenin-3-O-rhamnosyl(1→2)[glucosyl(1→6)]glucoside (compound 9), a steroidal saponin, is isolated from the variety yunnanensis of Paris polyphylla, commonly known as Yunnan pine [1].
TN1221	21-O-Tigloylgymnemagenin	21-O-Tigloylgymnemagenin	Others
	21-O-Tigloylgymnemagenin is a natural product		Others
TN6494	3-O-methylellagic acid 4'-O-alpha-L-rhamnopyranoside
	3-O-methylellagic acid 4'-O-alpha-L-rhamnopyranoside is a natural product for research related to life sciences. The catalog number is TN6494 and the CAS number is 51768-39-9.
T83460	11-O-β-D-glucopyranosyl thamnosmonin
	11-O-β-D-glucopyranosyl thamnosmonin is a coumarin glucoside extractable from the roots of Angelica apaensis that exhibits weak inhibitory effects on rabbit platelet aggregation induced by PAF, AA, and ADP [1].
TN3870	Iriflophenone 2-O-Rhamnoside	Dimethylmatairesinol	Others
	Dimethylmatairesinol can reduce the amount of Immunoglobulin E (IgE) secreted by human myeloma U266 cells, it has potential as an anti-allergic agent. Dimethylmatairesinol also exhibits significant cytotoxicity against t...		Others
T83344	3-O-β-D-Glucopyranosyl(1→2)-[a-Lrhamnopyranosyl(1→3)]-β-D-glucopyranosyl 28-O-β-D-glucuronopyranoside
	3-O-β-D-Glucopyranosyl(1→2)-[α-L-rhamnopyranosyl(1→3)]-β-D-glucopyranosyl 28-O-β-D-glucuronopyranoside is a saponin compound extracted from Polaskia chichipe Backbg. It demonstrates an 84.2% inhibitory activity on melani...
TN6535	Somnifericin
	Somnifericin is a natural product for research related to life sciences. The catalog number is TN6535 and the CAS number is 173693-57-7.
TN3430	Apigenin 4'-O-rhamnoside		Others
	Apigenin-4'-O-rhamnosylglucoside can strongly inhibit the classical pathway of the complement system.		Others
TN4878	Quercetin 3-O-sophoroside-7-O-rhamnoside		Others
	Quercetin 3-O-sophoroside-7-O-rhamnoside is a natural product of Viola, Violaceae. The catalog number is TN4878 and the CAS number is 64828-40-6. Quercetin 3-O-sophoroside-7-O-rhamnoside can be used as a reference standa...		Others
TN5683	Ethyl 4-(rhamnosyloxy)benzylcarbamate
	Ethyl 4-(rhamnosyloxy)benzylcarbamate is a natural product for research related to life sciences. The catalog number is TN5683 and the CAS number is 208346-80-9.
TN5244	Vitexin 2''-O-(4'''-O-acetyl)rhamnoside		Others
	Vitexin 2''-O-(4'''-O-acetyl)rhamnoside is a natural product for research related to life sciences. The catalog number is TN5244 and the CAS number is 80537-98-0.		Others
TN2009	Oleanolic acid 3-O-beta-D-glucosyl-(1->3)-alpha-L-rhamnosyl(1->2)-alpha-L-arabinoside		Others
	Oleanolic acid 3-O-beta-D-glucosyl-(1->3)-alpha-L-rhamnosyl(1->2)-alpha-L-arabinoside is a natural product		Others
TN1680	Genistein 7-O-β-D-glucopyranoside-4'-O-[α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside]	Genistein 7-O-beta-D-glucopyranoside-4'-O-[alpha-L-rhamnopyranosyl-(1->2)-beta-D-glucopyranoside]	Others
	Genistein 7-O-beta-D-glucopyranoside-4'-O-[alpha-L-rhamnopyranosyl-(1->2)-beta-D-glucopyranoside] is a natural product		Others
TN6648	3-O-[5'''-O-feruloyl-beta-D-apiofuranosyl(1'''->2'')-beta-D-glucopyranosyl] rhamnocitrin
	3-O-[5'''-O-feruloyl-beta-D-apiofuranosyl(1'''->2'')-beta-D-glucopyranosyl] rhamnocitrin is a natural product for research related to life sciences. The catalog number is TN6648 and the CAS number is 148210-00-8.
TN7046	α-L-Rhamnopyranose
	α-L-Rhamnopyranose is a natural product for research related to life sciences. The catalog number is TN7046 and the CAS number is 6014-42-2.
TN2150	Rhamnazin		Others
	Rhamnazin is a natural product		Others
TN1167	2-Methyl-1,3,6-trihydroxy-9,10-anthraquinone-3-O-α-rhamnosyl-(1→2)-β-D-glucoside	1,3,6-Trihydroxy-2-methylanthraquinone 3-O-(6'-O-acetyl)-alpha-L-rhamnosyl-(1->2)-Beta-D-glucoside	Antifection
	1,3,6-Trihydroxy-2-methylanthraquinone 3-O-(6'-O-acetyl)-alpha-L-rhamnosyl-(1->2)-Beta-D-glucoside shows certain antibacterial activity.		Antifection
TN1792	Isorhamnetin 3-glucoside-7-rhamnoside		Antifection
	An anti-oxidative composition containing isorhamnetin-3-glucoside-7-rhamnoside (IGR)isolated from Hippophae rhamnoides L. is provided to ensure antioxidative, antibacterial, and anti-cancer effect.		Antifection
------------------------ More ------------------------

Natural Products

2''-O-Rhamnosylicariside II

α-L-Rhamnose monohydrate

T2928

Synonym: L-Rhamnose monohydrate,6-deoxy-L-mannose monohydrate

Target: Others

Isorhamnetin

T2836

Synonym: 3-methylquercetin,3'-Methylquercetin,Isorhamnetol,3'-Methoxyquercetin

Target: MEK, PI3K, Endogenous Metabolite

Kaempferol-3-O-glucorhamnoside

T5S0089

Synonym: Kaempferol 3-glucorhamnoside

Target: Antioxidant, p38 MAPK, NF-κB

Kaempferol-3-O-β-D-glucosyl(1-2)rhamnoside

Ophiogenin 3-O-α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside

T3S1250

Synonym: Ophiogenin-3-O-alpha-L-rhaMnopyranosyl-(1->2)-beta-D-glucopyranoside

Target: Others

Didemnin B

T25327

Synonym: NSC 325319,NSC325319,NSC-325319,Didemnin-B

Target: Antiviral

Taxifolin 7-O-rhamnoside

TN2260

Synonym: Taxifolin 7-O-α-L-rhamnoside

Target: Others

β-D-glucopyranosyl-[α-L-rhamnopyranosyl-(1→3)-βD-glucuronopyranosyl-(1→3)]-3β-hydroxyolean-12-ene28-oate

TN6776

Synonym: Cyaonoside B

Target: Others

Rhamnetin

TN1419

Synonym: beta-Rhamnocitrin

Target: Others, Phospholipase

Vitexin-2"-O-rhamnoside

T3671

Synonym: 2''-O-Rhamnosylvitexin,Vitexin-2-O-rhaMnoside,Vitexin-2''-O-rhamnoside,Apigenin-8-C-glucoside

Target: Liver X Receptor

Isorhamnetin-3-O-glucoside

T5S1988

Synonym: Isorhamnetin-3-O-beta-D-Glucoside

Target: Others

Apigenin-7-O-(2G-rhamnosyl)gentiobioside

T5S1526

Synonym: Apigenin 7-O-(2G-rhamnosyl)gentiobioside,Apigenin 7-(2-Rhamnosylgentiobioside)

Target: Others

Quercetin 3-O-β-D-(6''-p-coumaroyl)glucopyranosyl(1→2)-α-L-rhamnopyranoside

TN2125

Synonym: Quercetin 3-O-beta-(6''-p-coumaroyl)glucopyranosyl(1->2)-alpha-L-rhamnopyranoside

Target: Antioxidant

Isorhamnetin-3-O-neohespeidoside

T3799

Synonym: Isorhamnetin 3-O-neohesperidin,Isorhamnetin 3-O-neohesperoside,Calendoflavoside

Target: Antioxidant

Rhamnose monohydrate

T6559

Synonym: L-(+)-Rhamnose Monohydrate

Target: Others

Rhamnose

T5120

Synonym: 6-Deoxyhexopyranose,6-Deoxy-L-mannose,alpha-L-Rhamnose

Target: Calcium Channel, Endogenous Metabolite

Isorhamnetin 3-robinobioside

TN4325

Synonym:

Target: Antioxidant

Ellagic acid 3-O-α-L-rhamnopyranoside

TN7213

Synonym:

Target: Others

(25R)-3β,17α-dihydroxy-5α- spirostan-6-one3-O-α-L- rhamnopyranosyl-(1→2)-β- D-glucopyranoside

TN7112

Synonym:

Target: Others

Quercetin-3-O-D-glucosyl]-(1-2)-L-rhamnoside

TN6734

Synonym: Quercetin 3-O-beta-D-glucosyl-(1->2)-rhamnoside

Target: Others

Catechin 3-rhamnoside

T4242

Synonym:

Target: Others

Isorhamnetin 3,7-di-O-β-D-glucopyranoside

TN1791

Synonym: Isorhamnetin 3,7-O-diglucoside

2,3-Didehydrosomnifericin

TN1205

Synonym:

Target: Others

4-Hydroxymethylphenol 1-O-rhamnoside

TN3044

Synonym:

Target: Others

Orientin 2''-O-rhamnoside

TN5525

Synonym: 2''-O-Rhamnosylorientin,Luteolin 8-C-neohesperidoside

Target:

(25R)-Ruscogenin-3-yl α-L-rhamnopyranosyl-(1→2)-[β-D-xylopyranosyl-(1→4)]-β-D-glucopyranoside

T83568

Synonym:

Target:

Acacetin 7-O-β-D-glucuronopyranosyl-(1→2)[α-L-rhamnopyranosyl-(1→6)]-β-D-glucopyranoside

T83209

Synonym:

Target:

Diosgenin-3-O-rhamnosyl(1→2)[glucosyl(1→6)]glucoside

T82549

Synonym:

Target:

21-O-Tigloylgymnemagenin

TN1221

Synonym: 21-O-Tigloylgymnemagenin

Target: Others

3-O-methylellagic acid 4'-O-alpha-L-rhamnopyranoside

TN6494

Synonym:

Target:

11-O-β-D-glucopyranosyl thamnosmonin

T83460

Synonym:

Target:

Iriflophenone 2-O-Rhamnoside

TN3870

Synonym: Dimethylmatairesinol

Target: Others

3-O-β-D-Glucopyranosyl(1→2)-[a-Lrhamnopyranosyl(1→3)]-β-D-glucopyranosyl 28-O-β-D-glucuronopyranoside

Apigenin 4'-O-rhamnoside

TN3430

Synonym:

Target: Others

Quercetin 3-O-sophoroside-7-O-rhamnoside

TN4878

Synonym:

Target: Others

Ethyl 4-(rhamnosyloxy)benzylcarbamate

TN5683

Synonym:

Target:

Vitexin 2''-O-(4'''-O-acetyl)rhamnoside

TN5244

Synonym:

Target: Others

Oleanolic acid 3-O-beta-D-glucosyl-(1->3)-alpha-L-rhamnosyl(1->2)-alpha-L-arabinoside

TN2009

Synonym:

Target: Others

Genistein 7-O-β-D-glucopyranoside-4'-O-[α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside]

TN1680

Synonym: Genistein 7-O-beta-D-glucopyranoside-4'-O-[alpha-L-rhamnopyranosyl-(1->2)-beta-D-glucopyranoside]

Target: Others

3-O-[5'''-O-feruloyl-beta-D-apiofuranosyl(1'''->2'')-beta-D-glucopyranosyl] rhamnocitrin

2-Methyl-1,3,6-trihydroxy-9,10-anthraquinone-3-O-α-rhamnosyl-(1→2)-β-D-glucoside

TN1167

Synonym: 1,3,6-Trihydroxy-2-methylanthraquinone 3-O-(6'-O-acetyl)-alpha-L-rhamnosyl-(1->2)-Beta-D-glucoside

Target: Antifection

Isorhamnetin 3-glucoside-7-rhamnoside

TN1792

Synonym:

Target: Antifection

--------- More ---------

Recombinant Proteins

Species：

Expression System：

Tag：

Cat No.	Product Name	Species	Expression System
TMPY-00690	Carbonic Anhydrase 9 Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Carbonic Anhydrase 9 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 42.5 kDa and the accession number is A0A0S2Z3D0.
TMPY-00689	Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc)	Human	HEK293 Cells
	Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 67.7 kDa and the accession number is A0A0S2Z3D0.
TMPY-06936	Carbonic Anhydrase 9 Protein, Human, Recombinant (His & Avi), Biotinylated	Human	HEK293 Cells
	Carbonic Anhydrase 9 Protein, Human, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 44.23 kDa and the accession number is NP_001207.2.
TMPY-06939	Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc & Avi), Biotinylated	Human	HEK293 Cells
	Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc & Avi), Biotinylated is expressed in HEK293 mammalian cells with hFc and Avi tag. The predicted molecular weight is 69.51 kDa and the accession number is NP_001207.2.
TMPJ-00104	SOD2 Protein, Human, Recombinant (E. coli, His)	Human	E. coli
	Superoxide Dismutase (SOD2) is a number of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. The SOD2 protein transforms to...
TMPJ-00105	SOD2 Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Superoxide Dismutase (SOD2) belongs to the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial matrix protein that forms a homotetramer and binds one manganese ion per subunit. SOD2 transforms toxic super...
TMPY-04915	HIV-1 (group M, subtype B, Isolate MN) gp120 Protein (His)	HIV	HEK293 Cells
	HIV-1 (group M, subtype B, Isolate MN) gp120 Protein (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 55.8 kDa and the accession number is Q9YUL5.
TMPK-00524	CA9/Carbonic Anhydrase IX Protein, Cynomolgus, Recombinant (His)	Cynomolgus	HEK293 Cells
	CA9 is a member of the carbonic anhydrases' family, that is often expressed in cancer cells under hypoxic condition. CA9 expression potentially contributes to the regulation of cancer cell differentiation and mediates tu...
TMPK-00283	CA9/Carbonic Anhydrase IX Protein, Human, Recombinant (His & Avi)	Human	HEK293 Cells
	CA9 is a member of the carbonic anhydrases' family, that is often expressed in cancer cells under hypoxic condition. CA9 expression potentially contributes to the regulation of cancer cell differentiation and mediates tu...
TMPY-04027	Glycophorin A Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Glycophorin A Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 9.4 kDa and the accession number is P02724.
TMPJ-00283	Carbonic Anhydrase 9 Protein, Human, Recombinant (Avi & His), Biotinylated	Human	HEK293 Cells
	Carbonic anhydrases IX (CA IX), also known as membrane antigen MN or CA9, is a member of the carbonic anhydrase (CA) family and may be involved in cell proliferation and cellular transformation. CAs are zinc metalloenzym...
TMPK-00029	Glycophorin A Protein, Human, Recombinant (hFc)	Human	HEK293 Cells
	Glycophorin A Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 34.7 kDa and the accession number is P02724-1.
TMPK-00817	Glycophorin A Protein, Mouse, Recombinant (hFc)	Mouse	HEK293 Cells
	Glycophorin A Protein, Mouse, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 38.1 kDa and the accession number is P14220.
TMPK-00534	Glycophorin A Protein, Cynomolgus, Recombinant (His)	Cynomolgus	HEK293 Cells
	Glycophorin A Protein, Cynomolgus, Recombinant (His) is expressed in HEK293 mammalian cells with C-His tag. The predicted molecular weight is 9 kDa and the accession number is A0A2K5WD82.
TMPK-00818	Glycophorin A Protein, Mouse, Recombinant (His)	Mouse	HEK293 Cells
	Glycophorin A Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with C-His tag. The predicted molecular weight is 12.4 kDa and the accession number is P14220.
TMPY-04583	AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Protein (His)	AcMNPV	Baculovirus Insect Cells
	AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Protein (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 54.2 kDa and the accession number is P17501.
TMPH-03436	MNT3 Protein, S. cerevisiae, Recombinant (His)	Saccharomyces cerevisiae	Baculovirus Insect Cells
	Mannosyltransferase involved in adding the 4th and 5th mannose residues of O-linked glycans. MNT3 Protein, S. cerevisiae, Recombinant (His) is expressed in Baculovirus insect cells with N-10xHis tag. The predicted molecu...
TMPK-01482	HLA-A*02:03&B2M&AFP (FMNKFIYEI) Tetramer Protein, Human, MHC (His & Avi)	Human	HEK293 Cells
	Alpha-fetoprotein (AFP), a specific liver cancer marker, T cells expressing AFP-CAR selectively degranulated, released cytokines, and lysed liver cancer cells that were HLA-A*02:01 /AFP while sparing cells from multiple ...
TMPK-01519	HLA-A*02:01&B2M&AFP (FMNKFIYEI) Tetramer Protein, Human, MHC (His & Avi)	Human	HEK293 Cells
	Alpha-fetoprotein (AFP), a specific liver cancer marker, T cells expressing AFP-CAR selectively degranulated, released cytokines, and lysed liver cancer cells that were HLA-A*02:01 /AFP while sparing cells from multiple ...
TMPK-01515	HLA-A*02:01&B2M&AFP (FMNKFIYEI) Monomer Protein, Human, MHC (His & Avi)	Human	HEK293 Cells
	Alpha-fetoprotein (AFP), a specific liver cancer marker, T cells expressing AFP-CAR selectively degranulated, released cytokines, and lysed liver cancer cells that were HLA-A*02:01 /AFP while sparing cells from multiple ...
TMPH-00625	FMN reductase Protein, E. coli, Recombinant (His)	E. coli	Baculovirus Insect Cells
	Catalyzes an NADPH-dependent reduction of FMN, but is also able to reduce FAD or riboflavin.
TMPK-01483	HLA-A*02:03&B2M&AFP (FMNKFIYEI) Monomer Protein, Human, MHC (His & Avi), Biotinylated	Human	HEK293 Cells
	Alpha-fetoprotein (AFP), a specific liver cancer marker, T cells expressing AFP-CAR selectively degranulated, released cytokines, and lysed liver cancer cells that were HLA-A*02:01 /AFP while sparing cells from multiple ...
TMPK-01417	HLA-A*02:03&B2M&AFP (FMNKFIYEI) Tetramer Protein, Human, MHC (His & Avi), PE-Labeled	Human	HEK293 Cells
	Alpha-fetoprotein (AFP), a specific liver cancer marker, T cells expressing AFP-CAR selectively degranulated, released cytokines, and lysed liver cancer cells that were HLA-A*02:01 /AFP while sparing cells from multiple ...
TMPK-01477	HLA-A*02:01&B2M&AFP (FMNKFIYEI) Monomer Protein, Human, MHC (His & Avi), Biotinylated	Human	HEK293 Cells
	Alpha-fetoprotein (AFP), a specific liver cancer marker, T cells expressing AFP-CAR selectively degranulated, released cytokines, and lysed liver cancer cells that were HLA-A*02:01 /AFP while sparing cells from multiple ...
TMPY-03406	NMNAT1 Protein, Human, Recombinant (His)	Human	Baculovirus Insect Cells
	NMNAT, also known as NMNAT1, is a member of the Nicotinamide-nucleotide adenylyltransferases. It is widely expressed with high levels in skeletal muscle, heart, liver, and kidney. NMNAT appears to have the ability to pro...
TMPK-01436	HLA-A*02:01&B2M&AFP (FMNKFIYEI) Tetramer Protein, Human, MHC (His & Avi), PE-Labeled	Human	HEK293 Cells
	Alpha-fetoprotein (AFP), a specific liver cancer marker, T cells expressing AFP-CAR selectively degranulated, released cytokines, and lysed liver cancer cells that were HLA-A*02:01 /AFP while sparing cells from multiple ...
TMPH-03435	MNT3 Protein, S. cerevisiae, Recombinant (E. coli, His)	Saccharomyces cerevisiae	E. coli
	Mannosyltransferase involved in adding the 4th and 5th mannose residues of O-linked glycans. MNT3 Protein, S. cerevisiae, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predict...
TMPK-01484	HLA-A*02:03&B2M&AFP (FMNKFIYEI) Monomer Protein, Human, MHC (His & Avi)	Human	HEK293 Cells
	Alpha-fetoprotein (AFP), a specific liver cancer marker, T cells expressing AFP-CAR selectively degranulated, released cytokines, and lysed liver cancer cells that were HLA-A*02:01 /AFP while sparing cells from multiple ...
TMPY-06700	LMNB2 Protein, Human, Recombinant (His)	Human	E. coli
	LMNB2 Protein, Human, Recombinant (His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 41.04 kDa and the accession number is Q03252.
TMPH-02920	SMN1 Protein, Mouse, Recombinant (His & Myc)	Mouse	HEK293 Cells
	SMN1 Protein, Mouse, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-10xHis and C-Myc tag. The predicted molecular weight is 35.3 kDa and the accession number is P97801.
TMPK-01146	LGMN Protein, Human, Recombinant (His)	Human	HEK293 Cells
	Recently, functional studies have demonstrated that legumain (LGMN) cleaves both amyloid β-protein precursor and tau, promoting senile plaques and formation of neurofibrillary tangles, which may play a crucial role in th...
TMPH-00133	AcMNPV Major capsid Protein (His & Myc)	AcMNPV	E. coli
	Most abundant structural protein of the nucleocapsid produced during the infection cycle. The monomers are arranged in stacked rings around the nucleoprotein core. AcMNPV Major capsid Protein (His & Myc) is expressed in ...
TMPH-00134	AcMNPV Viral cathepsin Protein (His & SUMO)	AcMNPV	E. coli
	Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. Accumulates within infected cells as an inactive proenzyme (proV-CATH), which is activated by proteo...
TMPY-04449	CDK7 & CCNH & MNAT1 Protein, Human, Recombinant (His)	Human	Baculovirus Insect Cells
	CDK7 & CCNH & MNAT1 Protein, Human, Recombinant (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 118.8 kDa and the accession number is P50613&P51946&P51948.
TMPH-00147	IBV (strain KB8523) Replicase polyprotein 1ab (His)	IBV	Baculovirus Insect Cells
	The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as...