Home Tools
Log in
Products Inhibitors Libraries Recombinant Proteins Kits Services Contact Us
Cart
Peptides Monoclonal Antibodies Dye Reagents PROTAC Virtual Screening TargetMol Kits Cell Counting Kit-8 (CCK-8) Inhibitor Cocktails Natural Products Phenols Alkaloids Flavonoids
Inhibitors Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK
Membrane transporter/Ion channel Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Compound Libraries Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD Drug-like Compound Libraries Fragment Libraries Custom Compound Library
Signaling Pathways Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling
DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK Membrane transporter/Ion channel
Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome
Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries
Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD
Drug-like Compound Libraries Compound Libraries for HTS/HCS
Fragment Libraries General Fragment Libraries Characteristic Fragment Libraries Custom Compound Library
TargetMol
Cytokines and Growth Factors •   Cytokines •   Growth Factors Receptor Proteins •   Fc Receptors •   Cytokines and Growth Factor Receptors
CD Proteins •   T Cell CD Proteins •   B Cell CD Proteins Immune Checkpoint Proteins •   Co-inhibitory Immune Checkpoint Proteins •   Co-stimulatory Immune Checkpoint Proteins
CAR-T Therapy Target Proteins •   Hematologic Malignancies Target Proteins •   Solid Tumors Target Proteins Enzymes •   Oxidoreductases,EC 1 •   Transferases,EC 2
Viral Proteins •   Coronavirus (CoV) Proteins •   Influenza Proteins Fluorescent Proteins Others

IBV (strain KB8523) Replicase polyprotein 1ab (His)

Catalog No. TMPH-00147

The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products.; NendoU is a Mn(2+)-dependent, uridylate-specific enzyme, which leaves 2'-3'-cyclic phosphates 5' to the cleaved bond. IBV (strain KB8523) Replicase polyprotein 1ab (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 30.1 kDa and the accession number is P12723.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
IBV (strain KB8523) Replicase polyprotein 1ab (His)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 491.00
100 μg 20 days $ 1,370.00
500 μg 20 days $ 1,960.00
Bulk Inquiry
Get quote
Contact us for more batch information
Biological Description
Technical Params
Product Properties
Description The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products.; NendoU is a Mn(2+)-dependent, uridylate-specific enzyme, which leaves 2'-3'-cyclic phosphates 5' to the cleaved bond. IBV (strain KB8523) Replicase polyprotein 1ab (His) is expressed in Baculovirus insect cells with C-6xHis tag. The predicted molecular weight is 30.1 kDa and the accession number is P12723.
Species IBV
Expression System Baculovirus Insect Cells
Tag C-6xHis
Accession Number P12723
Amino Acid GGGGQSFLAADNAVLVSTQCYKRHSYVEIPSNLLVQNGMSLKDGANLYVYKRVNGAFVTLPNTLNTQGRSYETFEPRSDVERDFLDMSEEDFVEKYGKDLGLQHILYGEVDKPQLGGLHTVIGMYRLLRANKLNAKSVTNSDSDVMQNYFVLADNGSYKQVCTVVDLLLDDFLELLRNILNEYGTNKSKVVTVSIDYHSINFMTWFEDGSIKTCYPQLQ
Construction 1-219 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 30.1 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted protein solutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products.; NendoU is a Mn(2+)-dependent, uridylate-specific enzyme, which leaves 2'-3'-cyclic phosphates 5' to the cleaved bond.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

recombinant recombinant-proteins proteins protein

 

CORPORATE
About Us Careers Privacy Notice Events & News Terms & Conditions
SUPPORT
Contact Us Worldwide Distributors Quality Control Technical Support
RESOURCE
Product Catalog Product Citations Signaling Pathways Solution Calculators
FOLLOW OUR
Social Network
Newsletter Subscription
Subscribe to receive our lastest product updates and special offers!
Corporate
Support
Resource
Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
TargetMol
Copyright © 2015-2024 TargetMol Chemicals Inc. All rights reserved.