Home Tools
Log in
Products Inhibitors Libraries Recombinant Proteins Kits Services Contact Us
Cart
Peptides Monoclonal Antibodies Dye Reagents PROTAC Virtual Screening TargetMol Kits Cell Counting Kit-8 (CCK-8) Inhibitor Cocktails Natural Products Phenols Alkaloids Flavonoids
Inhibitors Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK
Membrane transporter/Ion channel Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Compound Libraries Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD Drug-like Compound Libraries Fragment Libraries Custom Compound Library
Signaling Pathways Angiogenesis Apoptosis Autophagy Cell Cycle/Checkpoint Chromatin/Epigenetic Cytoskeletal Signaling
DNA Damage/DNA Repair Endocrinology/Hormones GPCR/G Protein Immunology/Inflammation JAK/STAT signaling MAPK Membrane transporter/Ion channel
Metabolism Microbiology/Virology Neuroscience NF-Κb oxidation-reduction PI3K/Akt/mTOR signaling Proteases/Proteasome
Stem Cells Tyrosine Kinase/Adaptors Ubiquitination PROTAC Others
Focused Bioactive Libraries General Bioactive Libraries Approved / Repurposing Disease Focused Target / Pathway Focused Characteristic Bioactive Libraries
Natural Product Libraries Natural Product Library for HTS Characteristic Natural Product Libraries Natural Product Derivatives Libraries Natural Product Library for CADD
Drug-like Compound Libraries Compound Libraries for HTS/HCS
Fragment Libraries General Fragment Libraries Characteristic Fragment Libraries Custom Compound Library
TargetMol
Cytokines and Growth Factors •   Cytokines •   Growth Factors Receptor Proteins •   Fc Receptors •   Cytokines and Growth Factor Receptors
CD Proteins •   T Cell CD Proteins •   B Cell CD Proteins Immune Checkpoint Proteins •   Co-inhibitory Immune Checkpoint Proteins •   Co-stimulatory Immune Checkpoint Proteins
CAR-T Therapy Target Proteins •   Hematologic Malignancies Target Proteins •   Solid Tumors Target Proteins Enzymes •   Oxidoreductases,EC 1 •   Transferases,EC 2
Viral Proteins •   Coronavirus (CoV) Proteins •   Influenza Proteins Fluorescent Proteins Others

Search Result

Search Results for " fn "

Targets

IFNAR FLT CDK

51

Compounds

2

Natural Products

175

Recombinant Proteins

Cat No. Product Name Synonyms Targets
T15335 FN-1501 FLT , CDK
FN-1501 is a potent FLT3 and CDK inhibitor (IC50s: 2.47, 0.85, 1.96, and 0.28 nM for CDK2/cyclin A, CDK4/cyclin D1, CDK6/cyclin D1 and FLT3, respectively). FN-1501 also has anticancer activity.
T71153 FN-439
FN-439 is a selective inhibitor of collagenase-1, characterized by an IC50 value of 1 μM, indicating its effectiveness in inhibiting this enzyme. Due to its specificity and activity, FN-439 serves as a valuable tool for ...
T13696 FN-1501-propionic acid CDK
FN-1501-propionic acid, a CDK2/9 ligand, in conjunction with a CRBN ligand, has been utilized in the design of a PROTAC CDK2/9 degrader.
T78117 FN-439 TFA MMP
FN-439 TFA is a selective inhibitor of collagenase-1, exhibiting inhibition with an IC50 of 1 μM, and is utilized in cancer and inflammation research [1] [2].
T82379 FN-A208 fusion peptide
FN-A208 is an active peptide combining A208 from murine laminin a1 with the fibronectin active site GRGDS, linked by a glycine spacer. This compound self-assembles into amyloid-like fibrils and facilitates fibroblast cel...
T71975 5-MPEP
5-MPEP is a neutral allosteric site ligand of the metabotropic glutamate receptor subtype 5 (mGlu5), blocking the effects of both the allosteric antagonist MPEP and potentiator CDPPB.
T41194 FFN 102 mesylate Others
FFN 102 mesylate is a pH responsive fluorescent false neurotransmitter (FFN), a selective dopamine transporter (DAT) and VMAT2 substrate. Exhibits no significant binding to a panel of 38 CNS receptors, including dopamine...
T83628 TNF/IFNγ-IN-1 Antioxidant , TNF , COX
TNF/IFNγ-IN-1 (TGA) is a dual inhibitor of TNF and IFN-γ. TNF/IFNγ-IN-1 has potential antioxidant and anti-inflammatory activities for neurodegenerative diseases such as Alzheimer.
T22781L FFN 511 hydrochloride FFN 511 hydrochloride(1004548-96-2 Free base)
FFN 511 hydrochloride is a fluorescent pseudo-neurotransmitters (FFNs) targeting neuronal vesicular monoamine transporter 2 (VMA T2).FFN 511 hydrochloride inhibits the binding of 5-hydroxytryptamine to VMA T2-containing ...
T4105 AFN-1252 Debio 1452,API-1252 Others , Antibacterial , Antibiotic
AFN-1252 (Debio 1452)(Debio 1452) is an effective inhibitor of enoyl-acyl carrier protein reductase (FabI). It (≤0.12 μg/ml) inhibits all Clinicalal isolates of Staphylococcus aureus and Staphylococcus epidermidis.
T41195 FFN 206 dihydrochloride
FFN 206 dihydrochloride is a fluorescent VMAT2 substrate that can be used to detect VMAT2 subcellular sites in cell culture and shows no detectable inhibition of DAT.
T131725 Compound TCFN92660
Compound TCFN92660 is a useful organic compound for research related to life sciences. The catalog number is T131725 and the CAS number is 56070-89-4.
T11630 IFN alpha-IFNAR-IN-1 hydrochloride Others , IFNAR
IFN alpha-IFNAR-IN-1 hydrochloride is an inhibitor of the interaction between IFN-α and IFNAR. IFN alpha-IFNAR-IN-1 hydrochloride inhibits MVA-induced IFN-α responses by BM-pDCs with IC50 of 2-8 μM.
T62123 FNDR-20123
FNDR-20123 is the first safe and effective anti-malarial HDAC inhibitor, acting on both Plasmodium falciparum HDAC (IC50: 31 nM) and human HDAC (IC50: 3 nM). FNDR-20123 inhibited HDAC1 (IC50: 25 nM), HDAC2 (IC50: 29 nM),...
T71539 AFN-1252 tosylate hydrate
AFN-1252, also known as AFN-12520000; API-1252; Debio-1452, is FASII Inhibitor which is potentially for the treatment of acute bacterial skin. AFN-1252 exhibits typical MIC(90) values of ≤0·015 μg/ml against diverse clin...
T71943 JFN05510
Also named as 3'-O-tert-Butyldimethylsilyl-5'-O-DMT-N2-isobutyrylguanosine 2'-CE phosphoramidite. This compound has been shown to be anticancer and can be used as an activator for enzymatic reactions.
T131726 Compound TCFN92881
Compound TCFN92881 is a useful organic compound for research related to life sciences. The catalog number is T131726 and the CAS number is 90536-47-3.
T131720 Compound TCFN95222
Compound TCFN95222 is a useful organic compound for research related to life sciences. The catalog number is T131720 and the CAS number is 52387-14-1.
T131730 Compound TCFN00444
Compound TCFN00444 is a useful organic compound for research related to life sciences. The catalog number is T131730 and the CAS number is 579-21-5.
T28393 Pfn1-IN-C2 Pfn1 inhibitor C2
Pfn1-IN-C2, an inhibitor of Profilin1 (Pfn1), has been shown to reduce the overall level of cellular filamentous (F)-actin, slow EC migration and proliferation, and inhibit the angiogenic ability of EC both in vitro and ...
T22781 FFN 511 Others
Fluorescent false neurotransmitter (FFN)
T72865 Sofnobrutinib AS-0871
Sofnobrutinib (AS-0871) is an orally active, selective inhibitor of Bruton's tyrosine kinase (BTK) demonstrating IC50 values of 4.2 nM (activated BTK) and 0.39 nM (unactivated BTK). Additionally, it displays an IC50 of 2...
T83851 Tat-QFNP12 TFA
Tat-QFNP12 is a peptide that combines a transcriptional transactivator (Tat) transmembrane domain with an inhibitor targeting the interaction between N-Myc downstream regulated gene 2 (NDRG2) and protein phosphatase Mg2+...
T39878 FFN270 hydrochloride FFN270 hydrochloride
FFN270 hydrochloride, a fluorescent tracer for norepinephrine and vesicular monoamine transporters, features dual resolved absorption/excitation peaks that vary with solvent pH (FFN270 ex: 320 nm or 365 nm, em: 475 nm). ...
T78263 Anti-Mouse IFNAR1 Antibody (MAR1-5A3) IFNAR
Anti-Mouse IFNAR1 Antibody (MAR1-5A3) is a neutralizing monoclonal antibody that specifically binds to IFNAR1, blocking its signaling both in vitro and in vivo. It is of the Mouse IgG1 kappa isotype and a corresponding i...
T61572 FNDR-20123 free base
FNDR-20123 free base, a pioneering and orally administered anti-malarial agent, acts as a Histone Deacetylase (HDAC) inhibitor, displaying potent efficacy with IC50 values of 31 nM for Plasmodium and 3 nM for human HDAC,...
T69812 AFN941
AFN941 is a staurosporine analog, acting as a Jak3-specific inhibitor.
T131721 Compound TCFN97859
Compound TCFN97859 is a useful organic compound for research related to life sciences. The catalog number is T131721 and the CAS number is 103476-99-9.
T31791 FFN246 HCl FFN 246,FFN246 hydrochloride,FFN246,FFN-246
FFN246 is a fluorescent substrate for both the serotonin transporter and the vesicular monoamine transporter 2 (VMAT2).
T81803 MFN2 agonist-1
MFN2 agonist-1 (B-A/l) effectively induces mitochondrial fusion in cells deficient in mitofusin 2 (MFN2). It counteracts mitochondrial "clumping" (formation of static mitochondrial aggregates) and reinstates mitochondria...
T64188 FNC-TP trisodium
FNC-TP trisodium is the intracellularly active form of FNC, a potent inhibitor of nucleoside reverse transcriptase (NRTI) that exhibits antiviral effects against HIV, HBV and HCV.
T76637 IFN-γ Antagonist 1
IFN-γ Antagonist 1 (AYCRDGKIGPPKLDIRKEEKQI), an interferon γ (IFN γ) antagonist, effectively inhibits IFN-γ induced HLR/DR antigen expression in Colon 205 cells, demonstrating an IC50 of approximately 35 μM. This compoun...
T76200 STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1].
T78684 FFN246 5-HT Receptor
FFN246, a fluorescent probe, concurrently targets the serotonin transporter (SERT) and vesicular monoamine transporter 2 (VMAT2), exhibiting excitation and emission spectra at 392/427 nm, respectively. It serves to label...
T81410 Prafnosbart DS-6016A
Prafnosbart (DS-6016A) is a humanized IgG1-kappa monoclonal antibody targeting ACVR1 (activin A receptor type 1, ACVRLK2, ALK2, ACVR1A, SKR1), utilized in research on bone metabolism disorders [1].
T78262 Anti-Mouse IFN gamma Antibody (H22) IFNAR
Anti-Mouse IFN Gamma Antibody is a host Armenian Hamster-derived anti-mouse IFN gamma immunoglobulin G (IgG) inhibitor.
T38158 StA-IFN-1
StA-IFN-1 is an inhibitor of the interferon (IFN) induction pathway with an IC50 value of 4.1 μM in a GFP reporter assay for IFN induction similar to TPCA-1 , which specifically inhibits the IKKβ component of the IFN ind...
T28392 Pfn1-IN-C1 Pfn1INC1,Pfn1 IN C1,Pfn1 inhibitor C1
Pfn1-IN-C1, an inhibitor of Profilin1 (Pfn1), has been shown to reduce the overall level of cellular filamentous (F)-actin, slow EC migration and proliferation, and inhibit the angiogenic ability of EC both in vitro and ...
TNU1508 DMTr-FNA-C(Bz)phosphoramidite
Nucleoside phosphoramidites；Nucleoside Derivatives - Acyclic nucleosides;
T4105L AFN-1252 tosylate API-1252 tosylate
AFN-1252 tosylate is an enoyl-ACP Reductase inhibitor.
T41193 FFN 270
FFN 270 is a fluorescent false neurotransmitter (FFN). Fluorescent substrate for NET and VMAT2. Labels noradrenergic neurons and their synaptic vesicles, and enables imaging of synaptic vesicle content release from speci...
TP1117 IFN-α Receptor Recognition Peptide 1 IRRP1
IFN-α Receptor Recognition Peptide 1, associated with receptor interactions, is a peptide of IFN-α.
T80234 SFNGGP-NH2
SFNGGP-NH2 is a biologically active peptide that interacts with Protease-Activated Receptor 3 (PAR-3), a high-affinity thrombin receptor. Human cutaneous mast cells express PAR-3 mRNA, implicating a role in itch mechanot...
T76638 IFN-γ Antagonist 1 acetate
IFN-γ Antagonist 1 (AYCRDGKIGPPKLDIRKEEKQI) acetate, an interferon γ (IFN γ) antagonist, effectively inhibits the expression of HLR/DR antigen in Colon 205 cells induced by IFN-γ, with an inhibition concentration (IC 50)...
T11630L IFN alpha-IFNAR-IN-1 Others
IFN alpha-IFNAR-IN-1 is a nonpeptidic, low-molecular-weight inhibitor of the interaction between IFN-α and IFNAR. It inhibits MVA-induced IFN-α responses by BM-pDCs (IC50: 2-8 μM).
T31790 FFN200 dihydrochloride FFN200 HCl,FFN200,FFN 200,FFN-200
FFN200 is a vesicular monoamine transporter 2 (VMAT2) substrate that selectively traces monoamine exocytosis in both neuronal cell culture and brain tissue.
T35835 FFN-102 (trifluoroacetate salt)
FFN-102 (trifluoroacetate salt) is a synthetic biogenic neurotransmitter analog with pH-dependent fluorescence and electroactivity.
T40120 FNC-TP
FNC-TP, the intracellular active form of FNC, is a potent nucleoside reverse transcriptase inhibitor (NRTI) with broad-spectrum antiviral activity against HIV, HBV, and HCV.
T131723 Compound TCFN91628
Compound TCFN91628 is a useful organic compound for research related to life sciences. The catalog number is T131723 and the CAS number is 724434-08-6.
T13783 MT-4 Others
MT-4 inhibits the adhesion of ovarian cancer (OC) cells to the peritoneum.

Compounds

FN-1501
T15335
Synonym:
Target: FLT, CDK
FN-439
T71153
Synonym:
Target:
FN-1501-propionic acid
T13696
Synonym:
Target: CDK
FN-439 TFA
T78117
Synonym:
Target: MMP
FN-A208 fusion peptide
T82379
Synonym:
Target:
5-MPEP
T71975
Synonym:
Target:
FFN 102 mesylate
T41194
Synonym:
Target: Others
TNF/IFNγ-IN-1
T83628
Synonym:
Target: Antioxidant, TNF, COX
FFN 511 hydrochloride
T22781L
Synonym: FFN 511 hydrochloride(1004548-96-2 Free base)
Target:
AFN-1252
T4105
Synonym: Debio 1452,API-1252
Target: Others, Antibacterial, Antibiotic
FFN 206 dihydrochloride
T41195
Synonym:
Target:
Compound TCFN92660
T131725
Synonym:
Target:
IFN alpha-IFNAR-IN-1 hydrochloride
T11630
Synonym:
Target: Others, IFNAR
FNDR-20123
T62123
Synonym:
Target:
AFN-1252 tosylate hydrate
T71539
Synonym:
Target:
JFN05510
T71943
Synonym:
Target:
Compound TCFN92881
T131726
Synonym:
Target:
Compound TCFN95222
T131720
Synonym:
Target:
Compound TCFN00444
T131730
Synonym:
Target:
Pfn1-IN-C2
T28393
Synonym: Pfn1 inhibitor C2
Target:
FFN 511
T22781
Synonym:
Target: Others
Sofnobrutinib
T72865
Synonym: AS-0871
Target:
Tat-QFNP12 TFA
T83851
Synonym:
Target:
FFN270 hydrochloride
T39878
Synonym: FFN270 hydrochloride
Target:
Anti-Mouse IFNAR1 Antibody (MAR1-5A3)
T78263
Synonym:
Target: IFNAR
FNDR-20123 free base
T61572
Synonym:
Target:
AFN941
T69812
Synonym:
Target:
Compound TCFN97859
T131721
Synonym:
Target:
FFN246 HCl
T31791
Synonym: FFN 246,FFN246 hydrochloride,FFN246,FFN-246
Target:
MFN2 agonist-1
T81803
Synonym:
Target:
FNC-TP trisodium
T64188
Synonym:
Target:
IFN-γ Antagonist 1
T76637
Synonym:
Target:
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
T76200
Synonym:
Target:
FFN246
T78684
Synonym:
Target: 5-HT Receptor
Prafnosbart
T81410
Synonym: DS-6016A
Target:
Anti-Mouse IFN gamma Antibody (H22)
T78262
Synonym:
Target: IFNAR
StA-IFN-1
T38158
Synonym:
Target:
Pfn1-IN-C1
T28392
Synonym: Pfn1INC1,Pfn1 IN C1,Pfn1 inhibitor C1
Target:
DMTr-FNA-C(Bz)phosphoramidite
TNU1508
Synonym:
Target:
AFN-1252 tosylate
T4105L
Synonym: API-1252 tosylate
Target:
FFN 270
T41193
Synonym:
Target:
IFN-α Receptor Recognition Peptide 1
TP1117
Synonym: IRRP1
Target:
SFNGGP-NH2
T80234
Synonym:
Target:
IFN-γ Antagonist 1 acetate
T76638
Synonym:
Target:
IFN alpha-IFNAR-IN-1
T11630L
Synonym:
Target: Others
FFN200 dihydrochloride
T31790
Synonym: FFN200 HCl,FFN200,FFN 200,FFN-200
Target:
FFN-102 (trifluoroacetate salt)
T35835
Synonym:
Target:
FNC-TP
T40120
Synonym:
Target:
Compound TCFN91628
T131723
Synonym:
Target:
MT-4
T13783
Synonym:
Target: Others
1 2
Cat No. Product Name Synonyms Targets
T5688 Micheliolide NOS , NF-κB , COX
Micheliolide(MCL) is a sesquiterpene lactone which inhibits various inflammatory response.
T2S2043 Dracorhodin perchlorate Dracorhodin perochlorate,Dracohodin perochlorate Apoptosis , Others
Dracorhodin perchlorate inhibits cell growth, and induces apoptosis in fibroblasts in a dose-and time-dependent manner, arresting cell cycle at G1 phase, may as a candidate for anti-breast cancer. Dracorhodin perchlorate...

Natural Products

Micheliolide
T5688
Synonym:
Target: NOS, NF-κB, COX
Dracorhodin perchlorate
T2S2043
Synonym: Dracorhodin perochlorate,Dracohodin perochlorate
Target: Apoptosis, Others

Recombinant Proteins

Species：
Human (74)
Mouse (45)
Rat (16)
Rhesus (12)
Cynomolgus (9)
Bovine (4)
Canine (3)
Chicken (2)
Danio rerio (zebrafish) (2)
Sheep (2)
Expression System：
HEK293 (125)
E. coli (26)
Yeast (12)
Human Cells (8)
CHO (2)
Baculovirus-Insect Cells (1)
in vitro E. coli expression system (1)
Tag：
His (57)
hFc (45)
Tag Free (14)
N-terminal 6xHis-tagged (13)
N-terminal 6xHis-SUMO-tagged (6)
C-His (5)
C-His-Avi (5)
C-hFc (5)
mFc (5)
C-Fc-6His (4)
Cat No. Product Name Species Expression System
TMPJ-01430 NovoNectin Protein, Human, Recombinant Human E. coli
Fibronectin1(FN1) is a secreted protein and contains 12 fibronectin type-I domains,fibronectin type-II domains and 16 fibronectin type-III domains.Recombinant human fibronectin fragment, is a protein of ~63 kDa containin...
TMPY-00803 Fibronectin Protein, Human, Recombinant (aa 607-1265, His) Human HEK293
Fibronectin (FN) is a glycoprotein component of the extracellular matrix of the extracellular matrix (ECM) with roles in embryogenesis, development, and wound healing. More recently, FN has emerged as player in platelet ...
TMPK-01389 Fibronectin Protein, Human, Recombinant (aa 32-345, His) Human HEK293
Fibronectin is a high molecular glycoprotein present in the blood, connective tissue and at cell surface. It is synthesized by many types of differentiated cells and is believed to be involved in the attachment of cells ...
TMPK-01373 Fibronectin Protein, Human, Recombinant (aa 1266-1356, hFc) Human HEK293
Fibronectin is a high molecular glycoprotein present in the blood, connective tissue and at cell surface. It is synthesized by many types of differentiated cells and is believed to be involved in the attachment of cells ...
TMPK-01390 Fibronectin Protein, Human, Recombinant (aa 32-602, His) Human HEK293
Fibronectin is a high molecular glycoprotein present in the blood, connective tissue and at cell surface. It is synthesized by many types of differentiated cells and is believed to be involved in the attachment of cells ...
TMPK-01391 Fibronectin Protein, Human, Recombinant (aa 1266-1356, His) Human HEK293
Fibronectin is a high molecular glycoprotein present in the blood, connective tissue and at cell surface. It is synthesized by many types of differentiated cells and is believed to be involved in the attachment of cells ...
TMPY-05562 Fibronectin Protein, Human, Recombinant (aa 1722-1811, His) Human HEK293
Fibronectin (FN) is a glycoprotein component of the extracellular matrix of the extracellular matrix (ECM) with roles in embryogenesis, development, and wound healing. More recently, FN has emerged as player in platelet ...
TMPJ-01433 Fibronectin Protein, Human, Recombinant (ED-B domain, Avi & His), Biotinylated Human E. coli
Fibronectin is a high-molecular weight glycoprotein of the extracellular matrix that binds to membrane-spanning receptor proteins called integrins. Similar to integrins, fibronectin binds extracellular matrix components ...
TMPY-02757 TWEAKR/TNFRSF12A Protein, Human, Recombinant (hFc) Human HEK293
Fn14 (tumor necrosis factor receptor superfamily, member 12A), also known as TNFRSF12A, is the receptor for TNFSF12/TWEAK. Fn14 shares 82% amino acid identity with the mouse sequence. It contains a signal peptide, an ext...
TMPJ-00745 IFN-alpha 2a/IFNA2 Protein, Human, Recombinant Human E. coli
At least 23 different variants of IFN-α are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-α subtypes possess a common ...
TMPY-00831 IFN-beta Protein, Human, Recombinant (hFc) Human HEK293
Interferons (IFNs) are natural glycoproteins belonging to the cytokine superfamily and are produced by the cells of the immune system of most vertebrates in response to challenges by foreign agents such as viruses, paras...
TMPY-03145 IFN-beta Protein, Human, Recombinant Human CHO
Interferons (IFNs) are natural glycoproteins belonging to the cytokine superfamily and are produced by the cells of the immune system of most vertebrates in response to challenges by foreign agents such as viruses, paras...
TMPK-00047 IFN gamma Protein, Human, Recombinant (His & Avi) Human HEK293
Interferon-gamma (IFN gamma) is a cytokine that plays physiologically important roles in promoting innate and adaptive immune responses. The absence of IFN gamma production or cellular responsiveness in humans and experi...
TMPY-02827 IFN gamma Protein, Rat, Recombinant (hFc) Rat HEK293
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ...
TMPY-04578 Interferon alpha 1/IFNA1 Protein, Human, Recombinant (His) Human Yeast
IFNA1, also known as IFN-alpha and IFNA, belongs to the alpha/beta interferon family. Interferons(IFNs) are proteins made and released by host cells in response to the presence of pathogens such as viruses, bacteria, par...
TMPY-03072 IFN-omega Protein, Human, Recombinant (His) Human HEK293
IFNs are a large family of proteins having antiviral, antiproliferative, and immunomodulatory effects, and are divided into two major classes, type I and type II, based on differences in receptor binding and nucleotide s...
TMPY-02355 IFNGR1 Protein, Mouse, Recombinant (His) Mouse HEK293
The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules associating with the immu...
TMPY-02515 Interferon alpha 7/IFNA7 Protein, Human, Recombinant (hFc) Human HEK293
Interferon alpha-7(IFNA7) is a member of the interferon family. Interferons belong to the group of the regulatory glycoproteins, of low molecular mass. They are the products of infected cell-genome, but not virus, as a c...
TMPY-00638 Interferon alpha B/IFNA8 Protein, Human, Recombinant (His) Human HEK293
Interferon alpha-B, also known as IFNA8, belongs to the alpha/beta interferon family. Interferons are proteins made and released by host cells in response to the presence of pathogens such as viruses, bacteria, parasites...
TMPY-05779 Ephrin A1/EFNA1 Protein, Human, Recombinant (hFc) Human HEK293
EPH-related receptor tyrosine kinase ligand 1 (abbreviated as Ephrin-A1) also known as ligand of eph-related kinase 1 or EFNA1, is a member of the ephrin (EPH) family. The Eph family receptor interacting proteins (ephrin...
TMPY-00007 Interferon alpha 2/IFNA2 Protein, Mouse, Recombinant Mouse Yeast
IFNA2 (Interferon Alpha 2) is a Protein Coding gene. This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Type I Interfero...
TMPY-03356 IFN gamma Protein, Mouse, Recombinant Mouse HEK293
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ...
TMPY-01151 IFNGR1 Protein, Human, Recombinant (His) Human HEK293
The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules associating with the immu...
TMPY-00265 Interferon alpha 2/IFNA2 Protein, Human, Recombinant Human Yeast
IFNA2 (Interferon Alpha 2) is a Protein Coding gene. This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Type I Interfero...
TMPJ-00746 IFN-alpha 2b/IFNA2 Protein, Human, Recombinant Human E. coli
At least 23 different variants of IFN-α are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-α subtypes possess a common ...
TMPY-02566 Interferon alpha 4/IFNA4 Protein, Human, Recombinant (His) Human Baculovirus-Insect Cells
Interferon, alpha 4 (IFNA4) belongs to the alpha/beta interferon family. Two variants of IFNA4 (IFNA4a and IFNA4b) are known, which differ from each other by changes in their coding regions at nucleotide positions 220 an...
TMPY-04799 IFNAR2 Protein, Human, Recombinant (His), Biotinylated Human HEK293
Interferon-alpha/beta receptor beta chain (IFNAR2) is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulate Janus protei...
TMPY-03467 IFN-beta Protein, Mouse, Recombinant Mouse HEK293
Interferons (IFNs) are natural glycoproteins belonging to the cytokine superfamily and are produced by the cells of the immune system of most vertebrates in response to challenges by foreign agents such as viruses, paras...
TMPY-02647 IFNAR1 Protein, Human, Recombinant (His) Human HEK293
Interferon-alpha/beta receptor alpha chain (IFNAR1) is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulate Janus prote...
TMPY-01714 IFN gamma Protein, Human, Recombinant Human CHO
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ...
TMPY-06983 IFN gamma Protein, Human, Recombinant (E. coli) Human E. coli
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ...
TMPH-00775 IFN gamma Protein, Goat, Recombinant (His & Myc) Goat E. coli
Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentatio...
TMPH-01550 Interferon kappa/IFNK Protein, Human, Recombinant (His & SUMO) Human E. coli
May play a role in the regulation of immune cell function. Cytokine that imparts cellular protection against viral infection in a species-specific manner. Activates the interferon-stimulated response element signaling pa...
TMPH-03495 IFN gamma Protein, Sheep, Recombinant (His) Sheep Yeast
Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentatio...
TMPH-01551 IFNLR1 Protein, Human, Recombinant (His & SUMO) Human E. coli
The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the ...
TMPH-00279 Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (His) Bovine Yeast
Paracrine hormone primarily responsible for maternal recognition of pregnancy. Interacts with endometrial receptors, probably type I interferon receptors, and blocks estrogen receptor expression, preventing the estrogen-...
TMPH-00784 Intimin Protein, Hafnia alvei, Recombinant (His & SUMO) Hafnia alvei E. coli
Necessary for the production of attaching and effacing lesions on tissue culture cells.
TMPH-00277 IFN-omega Protein, Bovine, Recombinant (His & SUMO) Bovine E. coli
IFN-omega Protein, Bovine, Recombinant (His & SUMO) is expressed in E. coli with N-terminal 6xHis-SUMO tag. The predicted molecular weight is 35.7 kDa. Accession number: P07352
TMPY-02347 IFN-alpha 13/IFNA13 Protein, Mouse, Recombinant (hFc) Mouse HEK293
IFN-alpha 13/IFNA13 Protein, Mouse, Recombinant (hFc) is expressed in HEK293 with hFc tag. The predicted molecular weight is 47.5 kDa. Accession number: Q80SU4
TMPY-02345 Interferon alpha 14/IFNA14 Protein, Mouse, Recombinant (hFc) Mouse HEK293
Interferon alpha 14/IFNA14 Protein, Mouse, Recombinant (hFc) is expressed in HEK293 with hFc tag. The predicted molecular weight is 47.4 kDa. Accession number: Q810G3
TMPY-03891 IFN-alpha 13/IFNA13 Protein, Mouse, Recombinant (His) Mouse HEK293
IFN-alpha 13/IFNA13 Protein, Mouse, Recombinant (His) is expressed in HEK293 with His tag. The predicted molecular weight is 20.5 kDa. Accession number: Q80SU4
TMPK-00075 IFN-alpha 1/IFNA1 Protein, Human, Recombinant (hFc) Human HEK293
IFN-α, a cytokine expressed in human islets from individuals affected by type 1 diabetes, plays a key role in the pathogenesis of diabetes by upregulating inflammation, endoplasmic reticulum (ER) stress and MHC class I o...
TMPJ-00747 IFN-alpha 2/IFNA2 Protein, Mouse, Recombinant Mouse E. coli
At least 23 different variants of Interferon-α are known. The individual proteins have molecular masses between 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-α subtypes possess a c...
TMPK-00223 Ephrin B2/EFNB2 Protein, Human, Recombinant (hFc) Human HEK293
Ephrin-B2 controls platelet-derived growth factor receptor β (PDGFRβ) distribution in the VSMC plasma membrane, endocytosis, and signaling in a fashion that is highly distinct from its role in the endothelium. Ephrin-B2 ...
TMPY-03927 IFNAR1 Protein, Rhesus, Recombinant Rhesus HEK293
Interferon-alpha/beta receptor alpha chain (IFNAR1) is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulate Janus prote...
TMPY-03735 Interferon alpha 2/IFNA2 Protein, Rhesus, Recombinant (His) Rhesus HEK293
IFNA2 (Interferon Alpha 2) is a Protein Coding gene. This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Type I Interfero...
TMPY-03828 IFN-beta Protein, Rhesus, Recombinant (mFc) Rhesus HEK293
Interferons (IFNs) are natural glycoproteins belonging to the cytokine superfamily and are produced by the cells of the immune system of most vertebrates in response to challenges by foreign agents such as viruses, paras...
TMPY-02863 Ephrin B1/EFNB1 Protein, Rat, Recombinant (hFc) Rat HEK293
Ephrin-B1 also known as EFNB1, is a member of the ephrin family. The transmembrane- associated ephrin ligands and their Eph family of receptor tyrosine kinases are expressed by cells of the SVZ. Eph/ephrin interactions a...
TMPY-03007 Ephrin A5/EFNA5 Protein, Rhesus, Recombinant (His) Rhesus HEK293
Ephrin-A5 also known as EFNA5, is a member of the Ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest kn...
TMPY-02740 Ephrin A5/EFNA5 Protein, Rat, Recombinant (His) Rat HEK293
Ephrin-A5 also known as EFNA5, is a member of the Ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest kn...
------------------------ More ------------------------
NovoNectin Protein, Human, Recombinant
TMPJ-01430
Species: Human
Expression System: E. coli
Fibronectin Protein, Human, Recombinant (aa 607-1265, His)
TMPY-00803
Species: Human
Expression System: HEK293
Fibronectin Protein, Human, Recombinant (aa 32-345, His)
TMPK-01389
Species: Human
Expression System: HEK293
Fibronectin Protein, Human, Recombinant (aa 1266-1356, hFc)
TMPK-01373
Species: Human
Expression System: HEK293
Fibronectin Protein, Human, Recombinant (aa 32-602, His)
TMPK-01390
Species: Human
Expression System: HEK293
Fibronectin Protein, Human, Recombinant (aa 1266-1356, His)
TMPK-01391
Species: Human
Expression System: HEK293
Fibronectin Protein, Human, Recombinant (aa 1722-1811, His)
TMPY-05562
Species: Human
Expression System: HEK293
Fibronectin Protein, Human, Recombinant (ED-B domain, Avi & His), Biotinylated
TMPJ-01433
Species: Human
Expression System: E. coli
TWEAKR/TNFRSF12A Protein, Human, Recombinant (hFc)
TMPY-02757
Species: Human
Expression System: HEK293
IFN-alpha 2a/IFNA2 Protein, Human, Recombinant
TMPJ-00745
Species: Human
Expression System: E. coli
IFN-beta Protein, Human, Recombinant (hFc)
TMPY-00831
Species: Human
Expression System: HEK293
IFN-beta Protein, Human, Recombinant
TMPY-03145
Species: Human
Expression System: CHO
IFN gamma Protein, Human, Recombinant (His & Avi)
TMPK-00047
Species: Human
Expression System: HEK293
IFN gamma Protein, Rat, Recombinant (hFc)
TMPY-02827
Species: Rat
Expression System: HEK293
Interferon alpha 1/IFNA1 Protein, Human, Recombinant (His)
TMPY-04578
Species: Human
Expression System: Yeast
IFN-omega Protein, Human, Recombinant (His)
TMPY-03072
Species: Human
Expression System: HEK293
IFNGR1 Protein, Mouse, Recombinant (His)
TMPY-02355
Species: Mouse
Expression System: HEK293
Interferon alpha 7/IFNA7 Protein, Human, Recombinant (hFc)
TMPY-02515
Species: Human
Expression System: HEK293
Interferon alpha B/IFNA8 Protein, Human, Recombinant (His)
TMPY-00638
Species: Human
Expression System: HEK293
Ephrin A1/EFNA1 Protein, Human, Recombinant (hFc)
TMPY-05779
Species: Human
Expression System: HEK293
Interferon alpha 2/IFNA2 Protein, Mouse, Recombinant
TMPY-00007
Species: Mouse
Expression System: Yeast
IFN gamma Protein, Mouse, Recombinant
TMPY-03356
Species: Mouse
Expression System: HEK293
IFNGR1 Protein, Human, Recombinant (His)
TMPY-01151
Species: Human
Expression System: HEK293
Interferon alpha 2/IFNA2 Protein, Human, Recombinant
TMPY-00265
Species: Human
Expression System: Yeast
IFN-alpha 2b/IFNA2 Protein, Human, Recombinant
TMPJ-00746
Species: Human
Expression System: E. coli
Interferon alpha 4/IFNA4 Protein, Human, Recombinant (His)
TMPY-02566
Species: Human
Expression System: Baculovirus-Insect Cells
IFNAR2 Protein, Human, Recombinant (His), Biotinylated
TMPY-04799
Species: Human
Expression System: HEK293
IFN-beta Protein, Mouse, Recombinant
TMPY-03467
Species: Mouse
Expression System: HEK293
IFNAR1 Protein, Human, Recombinant (His)
TMPY-02647
Species: Human
Expression System: HEK293
IFN gamma Protein, Human, Recombinant
TMPY-01714
Species: Human
Expression System: CHO
IFN gamma Protein, Human, Recombinant (E. coli)
TMPY-06983
Species: Human
Expression System: E. coli
IFN gamma Protein, Goat, Recombinant (His & Myc)
TMPH-00775
Species: Goat
Expression System: E. coli
Interferon kappa/IFNK Protein, Human, Recombinant (His & SUMO)
TMPH-01550
Species: Human
Expression System: E. coli
IFN gamma Protein, Sheep, Recombinant (His)
TMPH-03495
Species: Sheep
Expression System: Yeast
IFNLR1 Protein, Human, Recombinant (His & SUMO)
TMPH-01551
Species: Human
Expression System: E. coli
Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (His)
TMPH-00279
Species: Bovine
Expression System: Yeast
Intimin Protein, Hafnia alvei, Recombinant (His & SUMO)
TMPH-00784
Species: Hafnia alvei
Expression System: E. coli
IFN-omega Protein, Bovine, Recombinant (His & SUMO)
TMPH-00277
Species: Bovine
Expression System: E. coli
IFN-alpha 13/IFNA13 Protein, Mouse, Recombinant (hFc)
TMPY-02347
Species: Mouse
Expression System: HEK293
Interferon alpha 14/IFNA14 Protein, Mouse, Recombinant (hFc)
TMPY-02345
Species: Mouse
Expression System: HEK293
IFN-alpha 13/IFNA13 Protein, Mouse, Recombinant (His)
TMPY-03891
Species: Mouse
Expression System: HEK293
IFN-alpha 1/IFNA1 Protein, Human, Recombinant (hFc)
TMPK-00075
Species: Human
Expression System: HEK293
IFN-alpha 2/IFNA2 Protein, Mouse, Recombinant
TMPJ-00747
Species: Mouse
Expression System: E. coli
Ephrin B2/EFNB2 Protein, Human, Recombinant (hFc)
TMPK-00223
Species: Human
Expression System: HEK293
IFNAR1 Protein, Rhesus, Recombinant
TMPY-03927
Species: Rhesus
Expression System: HEK293
Interferon alpha 2/IFNA2 Protein, Rhesus, Recombinant (His)
TMPY-03735
Species: Rhesus
Expression System: HEK293
IFN-beta Protein, Rhesus, Recombinant (mFc)
TMPY-03828
Species: Rhesus
Expression System: HEK293
Ephrin B1/EFNB1 Protein, Rat, Recombinant (hFc)
TMPY-02863
Species: Rat
Expression System: HEK293
Ephrin A5/EFNA5 Protein, Rhesus, Recombinant (His)
TMPY-03007
Species: Rhesus
Expression System: HEK293
Ephrin A5/EFNA5 Protein, Rat, Recombinant (His)
TMPY-02740
Species: Rat
Expression System: HEK293
--------- More ---------
CORPORATE
About Us Careers Privacy Notice Events & News Terms & Conditions
SUPPORT
Contact Us Worldwide Distributors Quality Control Technical Support
RESOURCE
Product Catalog Product Citations Signaling Pathways Solution Calculators
FOLLOW OUR
Social Network
Newsletter Subscription
Subscribe to receive our lastest product updates and special offers!
Corporate
Support
Resource
Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
TargetMol
Copyright © 2015-2024 TargetMol Chemicals Inc. All rights reserved.