Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (His)

Name: Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (His)
Brand: TargetMol
SKU: TMPH-00279
Rating: 4.5 (1 reviews)

(Synonyms: Trophoblastin, Trophoblast protein 1 (TP-1), Trophoblast antiluteolytic protein, Interferon tau-1, IFN-tau-1, IFNT1, Antiluteolysin) Copy Product Info

Synonyms: Trophoblastin, Trophoblast protein 1 (TP-1), Trophoblast antiluteolytic protein, Interferon tau-1, IFN-tau-1, IFNT1, Antiluteolysin

Catalog No. TMPH-00279 Copy Product Info

Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.8 kDa and the accession number is P15696.

Pack Size	Price	USA Stock	Global Stock
5 μg	$143	20 days	20 days
10 μg	$238	20 days	20 days
20 μg	$397	20 days	20 days
50 μg	$597	20 days	20 days
100 μg	$845	20 days	20 days
200 μg	$1,190	20 days	20 days
500 μg	$1,950	20 days	20 days

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Resource Download

User Guide of Recombinant Proteins

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.8 kDa and the accession number is P15696.
Species	Bovine
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P15696
Amino Acid	CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL
Construction	24-195 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Synonyms	Trophoblastin, Trophoblast protein 1 (TP-1), Trophoblast antiluteolytic protein, Interferon tau-1, IFN-tau-1, IFNT1, Antiluteolysin
Research Background

Chemical Properties

Molecular Weight

21.8 kDa (predicted)

Storage & Solubility Information

Storage

Lyophilized powder: -20~-80°C for 1 year | Solution: -80°C for 6 months

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

TP-1TP1Interferon tau1IFNtau1IFNT 1

Related Tags: Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (His) chemical structure | Interferon tau-1/IFNT1 Protein, Bovine, Recombinant (His) molecular weight