111
6
35
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T15446 | GT 949 | transporter | |
GT 949 is a selective excitatory positive allosteric modulator of amino acid transporter-2 (EAAT2) (EC50: 0.26 nM). | |||
T5415 | γ-GT | H-GLA(PNA)-OH | Others |
γ-GT (H-GLA(PNA)-OH) is used as a synthetic substrate for gamma-glutamyltransferase (GGT) to determine GGT activity. | |||
T19692 | Deferitrin | GT 56252,GT 56 252,GT-56252,GT-56-252 | Others |
Deferitrin (GT-56-252) is an iron chelator. It potentially for the treatment of thalassemia and iron overload. | |||
T38824 | GT-1 | LCB10-0200,GT-1 | |
GT-1 (LCB10-0200) is a siderophore-linked cephalosporin compound that effectively combats clinical isolates of various bacterial species, including P. aeruginosa, Klebsiella oxytoca, Proteus spp., Serratia marcescens, an... | |||
T70111 | GT-2394 | ||
GT-2394 is a histamine H3 receptor agonist. | |||
T69756 | GT-2331 | ||
GT-2331 is a histamine H3 receptor antagonist. | |||
T22823 | GT 2016 | Others | |
GT 2016 is a H3 receptor antagonist. | |||
T70112 | GT-2227 | ||
GT-2227 is a histamine H3 receptor antagonist. | |||
T20623 | Thifensulfuron-methyl | Harmony GT,Refine,Pinnacle | Others |
Thifensulfuron-methyl (Pinnacle) is a sulfonylurea (SU) herbicide, has an important role in the removal of broadleaf weeds. | |||
T70643 | GT-0198 HCl | ||
GT-0198 is a novel glycine transporter 2 inhibitor showed activity in a mouse model of neuropathic pain. GT-0198 inhibited the function of glycine transporter 2 (GlyT2) in human GlyT2-expressing HEK293 cells and did not ... | |||
T27606 | Indantadol HCl | CHF-3381,CMP-3381,GT-3381,V-3381,CNP-3381,Indantadol | MAO , NMDAR |
Indantadol HCl (CHF-3381) is a NMDA antagonist and nonselective MAO inhibitor. | |||
T62930 | GT-055 | ||
GT-055 (LCB18-055) is a novel inhibitor of broad-spectrum β-lactamase. | |||
T14970 | Cipralisant | GT-2331 | Others |
Cipralisant is a selective histamine H3 receptor antagonist in vivo, and an agonist in vitro (pKi: 9.9 for histamine H3 receptor; Ki: 0.47 nM for rat histamine H3 receptor). It has the potential for the treatment of atte... | |||
T27022 | Cipralisant maleate | GT-2331,Cipralisant maleate. trade name Perceptin,GT 2331,GT2331 | |
Cipralisant maleate is a potent, selective Histamine H3 receptor antagonist. | |||
T69227 | GT951 | ||
GT951 is a EAAT2 activator. | |||
T33300 | Metachrome yellow | Acid Chrome Yellow 2GW,Java Unichrome Yellow GT,Alizarin Yellow GG,RV 1,C.I. 14025 | |
Metachrome yellow is a dye. | |||
T70641 | Asoxime dimethanesulfonate | ||
Asoxime dimethanesulfonate is an oxime reactivator used for counteracting intoxication by nerve agents. It is able to reactivate acetylcholinesterase (AChE) inhibited by cytotoxic nerve agents such as sarin or soman. | |||
T68939 | GT11 | ||
GT-11 is an inhibitor of dihydroceramides (DHCer) desaturase activity. | |||
T69755 | Evatanepag sodium | ||
Evatanepag, also known as CP-533536, is an EP2 receptor selective prostaglandin E2 (PGE2) agonist that induces local bone formation. CP-533536 demonstrated the ability to heal fractures when administered locally as a sin... | |||
T70110 | CVS-1578 | ||
CVS-1578 is a potent serine protease inhibitor, targeting the S2S3 thrombin and FXa subsites. | |||
T69219 | NIBR-1282 | ||
NIBR-1282 is a CCR5 antagonist. | |||
T36862 | Ganglioside GT1b Mixture (sodium salt) | Ganglioside GT1b Mixture (sodium salt),Ganglioside G1 Mixture | |
Ganglioside GT1b is a trisialoganglioside that is characterized by having two sialic residues linked to the inner galactose unit. It binds to the neurotoxins botulinum toxin serotype A (BTxA), BTxA heavy chain, and tetan... | |||
T11282 | FGTI-2734 | Transferase | |
FGTI-2734 is a dual farnesyl transferase (FT) and geranylgeranyl transferase-1 (GGT-1) inhibitor, exhibiting IC50 values of 250 nM and 520 nM for FT and GGT-1, respectively. It effectively prevents the membrane localizat... | |||
T2663 | GTS-21 dihydrochloride | GTS 21 dihydrochloride,DMXB-A,DMBX-anabaseine | 5-HT Receptor , AChR |
GTS-21 dihydrochloride (DMBX-anabaseine) is a nAChRs agonist. nAChRs are neuron receptor proteins that activated by the binding of the neurotransmitter ACh. | |||
T12692 | RAS GTPase inhibitor 1 | Raf | |
RAS GTPase inhibitor 1 is a RAS GTPase inhibitor with potential antitumor activity. | |||
TP1381L | HAEGT TFA(852155-81-8 free base) | Others | |
HAEGT TFA is the first N-terminal 1-5 residues of GLP-1 peptide. | |||
TP1419L | HAEGTFT acetate(926018-95-3 free base) | Glucagon Receptor | |
HAEGTFT acetate is the first N-terminal 1-7 residues of GLP-1 peptide. | |||
T6844 | GGTI298 Trifluoroacetate | GGTI 298,GGTI 298 TFA salt | Apoptosis , Transferase , Ras |
GGTI298 Trifluoroacetate (GGTI 298 TFA salt) is a geranylgeranyltransferase I inhibitor with ability to arrest human tumor cells in the G1 phase of the cell cycle and induce apoptosis. | |||
T71857 | GTP-14564 | FLT , Tyrosine Kinases | |
GTP-14564 is a novel tyrosine kinase inhibitor that also inhibits wt-FLT3 and ITD-FLT3. GTP-14564 inhibits the growth of interleukin-3-independent Ba/F1 expressing ITD-FLT3 at 3 μ m, whereas a 30-fold higher concentratio... | |||
T24088 | GGTI-2133 | GGTI2133,GGTI 2133 | Transferase |
GGTI-2133 is a potent mimetic peptidyl geranylgeranyltransferase type I inhibitor (GGTase I) with an IC50 value of 38 nM.GGTI-2133 inhibits the invasion of inflammatory cells into the airways in experimental asthma in mi... | |||
T40192 | DGTP | 2'-Deoxyguanosine-5'-triphosphate | Nucleoside Antimetabolite/Analog , DNA/RNA Synthesis |
dGTP (2'-Deoxyguanosine-5'-triphosphate) is one of the guanosine nucleotides which is highly susceptible to oxidative damage to 8-O-GDP, 8-O-dGTP, 8-O-GTP, and 8-O-dGTP. | |||
T25450L | GGTI 2147 FA | GGTI2147 FA,GGTI-2147 FA,GGTI 2147 FA(191102-87-1 Free base) | Others |
GGTI 2147 FA, a selective GGT inhibitor, abolishes bicuculline-induced increase in dendritic spine density in hippocampal experiments and may reduce learning and memory abilities in mice. | |||
T6072 | BGT226 maleate | BGT226,NVP-BGT226 (maleate),NVP-BGT226 | Apoptosis , PI3K , mTOR , Autophagy |
BGT226 maleate (NVP-BGT226) is a class I PI3K/mTOR inhibitor for PI3Kα/β/γ (IC50: 4/63/38 nM) . | |||
TP1388 | HAEGTFTSDVSSYLE | Others | |
HAEGTFTSDVSSYLE is a peptide. GLP-I analog contains the sequence. | |||
T16380 | OGT 2115 | Others | |
OGT 2115 is an inhibitor of heparanase (IC50 = 0.4 µM), an enzyme that cleaves heparan sulfate into glucuronic acid (GlcUA) and N-acetylglucosamine (GlcNAc). OGT 2115 also showed antiangiogenic properties (IC50=1 μM). | |||
TP1382L | HAEGTFTSDVS acetate | HAEGTFTSDVS acetate(864915-61-7 free base) | Glucagon Receptor |
HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells. | |||
T25450 | GGTI 2147 | GGTI2147,Geranylgeranyl transferase inhibitor-2147,GGTI-2147 | NF-κB , Rho |
GGTI 2147 decreased Rac1 activity, down-regulated p65 expression, and ameliorated OGD/R-induced neuronal apoptosis. | |||
T9711 | OGT-IN-2 | Others | |
OGT-IN-2 is a potent O-GlcNAc transferase (OGT) inhibitor. OGT-IN-2 inhibits sOGT and ncOGT with IC50 values of 30 μM and 53 μM, respectively[1]. OGT-IN-2 can be used for the research of articular diseases[1]. | |||
T4585 | EGTA | Ethylenebis(oxyethylenenitrilo)tetraacet | Others |
Ethylenebis(oxyethylenenitrilo)tetraacet is a diether that is ethylene glycol in which the hydrogens of the hydroxy groups have been replaced by 2-[bis(carboxymethyl)amino]ethyl group respectively. | |||
T6072L | BGT226 | BGT226 free base,NVP-BGT226 | PI3K , mTOR , Autophagy |
BGT226 (NVP-BGT226) is a novel dual PI3K / mTOR inhibitor, it acts on PI3K α/β/γ with IC50 of 4 nM / 63 nM / 38 nM, respectively. | |||
T83247 | 7-Deaza-dGTP tetralithium | ||
7-Deaza-dGTP tetralithium is utilized for the amplification of GC-rich DNA sequences [1]. | |||
T39857 | 8-Br-GTP | 8-Bromoguanosine-5'-triphosphate,8-Br-GTP | |
8-Br-GTP, an analog of GTP, functions as both a competitive inhibitor of FtsZ polymerization and GTPase activity (with a K i value of 31.8 μM). Moreover, it is capable of facilitating nucleic acid modification. | |||
T75418 | Alpha-1,3-Galactosyltransferase (GTB) | ||
Alpha-1,3-Galactosyltransferase (GTB) (alpha 1,3GT) is responsible for catalyzing the synthesis of the α-galactose (α-Gal) epitope, known as a xenoantigen. This enzyme facilitates the transfer of galactose from UDP-Gal t... | |||
T75413 | Beta-1,4-Galactosyltransferase (LgtB) | ||
Beta-1,4-Galactosyltransferase (LgtB) (B4GALT1(LgtB)), a key enzyme in biochemical research, catalyzes the transfer of UDP-galactose to N-acetylglucosamine, resulting in the synthesis of galactose beta-1,4-N-acetylglucos... | |||
T78376 | Rimtoregtide | ||
Rimtoregtide, a polypeptide, markedly attenuates the elevations in blood amylase and lipase levels associated with acute pancreatitis, suggesting its potential utility in the research of pancreatitis and acute pancreatit... | |||
T80439 | GTx1-15 | Sodium Channel | |
GTx1-15, an inhibitor cystine knot (ICK) peptide, antagonizes the voltage-dependent calcium channel Cav3.1, as well as voltage-dependent sodium channels Nav1.3 and Nav1.7 [1]. | |||
T75860 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | |||
TP2287 | Rac GTPase fragment | Others | |
Rac GTPase fragment is a peptide with the sequence H2N-Val-Phe-Asp-Glu-Ala-Ile-Arg-Ala-Val-OH, MW= 1019.15. Rac is a subfamily of the Rho family of GTPases, small signaling G proteins (more specifically a GTPase). | |||
T76252L | WLSEAGPVVTVRALRGTGSW TFA | ||
WLSEAGPVVTVRALRGTGSW TFA, a cardiomyocyte-specific peptide, exhibits enhanced performance through its expression in exosomes, which notably improves uptake by cardiomyocytes, reduces apoptosis within these cells, and inc... | |||
TP2254 | GTP-Binding Protein Fragment, G alpha | Others | |
Using specific antisera raised against synthetic peptides, we find that three distinct GTP-binding protein alpha subunits remain bound to the plasma membrane even after activation with nonhydrolyzable GTP analog. Trypsin... |
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T3380 | Homoharringtonine | Myelostat,Ceflatonin,HHT,Omacetaxine mepesuccinate | STAT |
Homoharringtonine (HHT) is a natural alkaloid that inhibits the translation of proteins and is cytotoxic. Homoharringtonine acts on the ribosomes of tumor cells to inhibit the elongation step of protein translation, ther... | |||
T8286 | Harringtonine | Others , Influenza Virus | |
Harringtonine, a natural Cephalotaxus alkaloid, inhibits protein synthesis. | |||
T75704 | Isoharringtonine | ||
Isoharringtonine, a natural alkaloid extracted from Cephalotaxus koreana Nakai, exhibits potent anticancer properties, including the inhibition of cancer cell proliferation and migration, along with the induction of apop... | |||
TN6238 | Harringtonolide | ||
Harringtonolide is a natural product for research related to life sciences. The catalog number is TN6238 and the CAS number is 64761-48-4. | |||
T83300 | 5′-Des-O-methylharringtonine | ||
5′-Des-O-methylharringtonine, a natural product, can be isolated from Cephalotaxus harringtonia [1]. | |||
T82365 | Fulvotomentoside B | ||
Fulvotomentoside B, a saponin derived from Lactobacillus flavus, displays hepatoprotective properties. It notably decreases serum glutamate pyruvate transaminase (SGPT) and triacylglycerol (GT) concentrations in mice sub... |
Cat No. | Product Name | Species | Expression System |
---|---|---|---|
TMPH-03512 | GT Protein, Solanum melongena, Recombinant (His & Myc) | Solanum melongena | Baculovirus Insect Cells |
In the presence of other necessary color factors, this glycosylation reaction allows the accumulation of anthocyanin pigments. GT Protein, Solanum melongena, Recombinant (His & Myc) is expressed in Baculovirus insect cel... | |||
TMPY-04775 | CDK1 Protein, Mouse, Recombinant (His & GST) | Mouse | Baculovirus Insect Cells |
CDK1 Protein, Mouse, Recombinant (His & GST) is expressed in Baculovirus insect cells with His and GST tag. The predicted molecular weight is 61.9 kDa and the accession number is P11440. | |||
TMPJ-00529 | FABP6 Protein, Human, Recombinant (His) | Human | E. coli |
Fatty Acid-Binding Protein 6 (FABP6) is cytoplasmic protein that binds long-chain fatty acids and other hydrophobic ligands which belongs to the calycin superfamily. FABP6 expression is restricted in the small intestine ... | |||
TMPY-01291 | B4GALT1 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
B4GALT1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 41.5 kDa and the accession number is P15291-1. | |||
TMPY-06061 | Influenza B (B/Washington/02/2019) Nucleoprotein/NP Protein (His) | Influenza B | Baculovirus Insect Cells |
Influenza B (B/Washington/02/2019) Nucleoprotein/NP Protein (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 63 kDa. | |||
TMPH-00009 | OGT Protein, Human, Recombinant (His & SUMO) | Human | E. coli |
OGT Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 62.5 kDa and the accession number is O15294. | |||
TMPY-05922 | Influenza B (B/Washington/02/2019) Hemagglutinin/HA Protein (His) | Influenza B | HEK293 Cells |
Influenza B (B/Washington/02/2019) Hemagglutinin/HA Protein (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 58.6 kDa. | |||
TMPJ-00679 | SGTA Protein, Human, Recombinant (His) | Human | E. coli |
Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein α (SGTA) is an ubiquitously expressed protein which belongs to the SGT Family. SGTA contains three TPR Protein-Protein Interaction Duplicates. SGTA is a co... | |||
TMPH-03078 | CGTases Protein, Paenibacillus macerans, Recombinant (His) | Bacillus macerans | P. pastoris (Yeast) |
CGTases Protein, Paenibacillus macerans, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is P31835. | |||
TMPH-00401 | LGTase Protein, Citrus unshiu, Recombinant (His & Myc) | Citrus unshiu | Baculovirus Insect Cells |
LGTase Protein, Citrus unshiu, Recombinant (His & Myc) is expressed in Baculovirus. | |||
TMPH-00090 | UGT71C1 Protein, Arabidopsis thaliana, Recombinant (E. coli, His) | Arabidopsis thaliana | E. coli |
Possesses quercetin 7-O-glucosyltransferase and 3'-O-glucosyltransferase activities in vitro. Also active in vitro on benzoates and benzoate derivatives. Glucosylates other secondary metabolites in vitro like trans-resve... | |||
TMPH-00568 | 8-oxo-dGTP diphosphatase Protein, E. coli, Recombinant (His & SUMO) | E. coli | E. coli |
8-oxo-dGTP diphosphatase Protein, E. coli, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.9 kDa and the accession number is P08337. | |||
TMPH-00091 | UGT71C1 Protein, Arabidopsis thaliana, Recombinant (Baculovirus, His) | Arabidopsis thaliana | P. pastoris (Yeast) |
Possesses quercetin 7-O-glucosyltransferase and 3'-O-glucosyltransferase activities in vitro. Also active in vitro on benzoates and benzoate derivatives. Glucosylates other secondary metabolites in vitro like trans-resve... | |||
TMPH-00112 | UGT72E2 Protein, Arabidopsis thaliana, Recombinant (Baculovirus, His & Myc) | Arabidopsis thaliana | Baculovirus Insect Cells |
Involved in the O-glucosylation of monolignols (alcohol monomers of lignin). Glucosylates coniferyl alcohol to form coniferyl alcohol 4-O-glucoside. Glucosylates sinapyl alcohol to form sinapyl alcohol 4-O-glucoside. Glu... | |||
TMPH-00113 | UGT78D1 Protein, Arabidopsis thaliana, Recombinant (His) | Arabidopsis thaliana | E. coli |
Flavonol 3-O-rhamnosyltransferase that catalyzes the transfer of rhamnose from UDP-rhamnose to the 3-OH position of kaempferol and quercetin. Possesses low quercetin 3-O-glucosyltransferase activity in vitro. UGT78D1 Pro... | |||
TMPH-00111 | UGT72E2 Protein, Arabidopsis thaliana, Recombinant (E. coli, His & Myc) | Arabidopsis thaliana | E. coli |
Involved in the O-glucosylation of monolignols (alcohol monomers of lignin). Glucosylates coniferyl alcohol to form coniferyl alcohol 4-O-glucoside. Glucosylates sinapyl alcohol to form sinapyl alcohol 4-O-glucoside. Glu... | |||
TMPH-00114 | UGT88A1 Protein, Arabidopsis thaliana, Recombinant (His & Myc) | Arabidopsis thaliana | Baculovirus Insect Cells |
Possesses low quercetin 3-O-glucosyltransferase, 7-O-glucosyltransferase, 3'-O-glucosyltransferase and 4'-O-glucosyltransferase activities in vitro. UGT88A1 Protein, Arabidopsis thaliana, Recombinant (His & Myc) is expre... | |||
TMPH-02268 | AGTR2 Protein, Human, Recombinant (His & SUMO) | Human | E. coli |
Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation. | |||
TMPY-03857 | MMGT1 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
MMGT1 (Membrane Magnesium Transporter 1, also known as EMC5 and TMEM32) is a Protein Coding gene. 2 alternatively spliced human isoforms have been reported. The encoded protein belongs to the membrane magnesium transport... | |||
TMPH-00116 | UGT89C1 Protein, Arabidopsis thaliana, Recombinant (Yeast, His) | Arabidopsis thaliana | P. pastoris (Yeast) |
UGT89C1 Protein, Arabidopsis thaliana, Recombinant (Yeast, His) is expressed in yeast with N-10xHis tag. The predicted molecular weight is 50.6 kDa and the accession number is Q9LNE6. | |||
TMPY-06167 | Influenza B (B/Washington/02/2019) Neuraminidase/NA Protein (His) | Influenza B | Baculovirus Insect Cells |
Influenza B (B/Washington/02/2019) Neuraminidase/NA Protein (His) is expressed in Baculovirus insect cells with His tag. The predicted molecular weight is 53.6 kDa. | |||
TMPY-03115 | GGT1 Protein, Rat, Recombinant (His) | Rat | HEK293 Cells |
GGT1 Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 61.1 kDa and the accession number is P07314. | |||
TMPH-00110 | UGT72B1 Protein, Arabidopsis thaliana, Recombinant (His & Myc) | Arabidopsis thaliana | E. coli |
Bifunctional O-glycosyltransferase and N-glycosyltransferase that can detoxify xenobiotics. Possesses high activity to metabolize the persistent pollutants 2,4,5-trichlorophenol (TCP) and 3,4-dichloroaniline (DCA). Also ... | |||
TMPH-03077 | CGTases Protein, Paenibacillus macerans, Recombinant (E. coli, His) | Paenibacillus macerans | E. coli |
N/A. CGTases Protein, Paenibacillus macerans, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.4 kDa and the accession number is P31835. | |||
TMPH-02267 | AGTRAP Protein, Human, Recombinant (His & Myc & SUMO) | Human | E. coli |
Appears to be a negative regulator of type-1 angiotensin II receptor-mediated signaling by regulating receptor internalization as well as mechanism of receptor desensitization such as phosphorylation. Induces also a decr... | |||
TMPY-00196 | GGT5 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
GGT5 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 61.8 kDa and the accession number is P36269-1. | |||
TMPY-06971 | GGT1 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
GGT1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 60.05 kDa and the accession number is P19440.2. | |||
TMPH-00115 | UGT89C1 Protein, Arabidopsis thaliana, Recombinant (E. coli, His) | Arabidopsis thaliana | E. coli |
UGT89C1 Protein, Arabidopsis thaliana, Recombinant (E. coli, His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 51.6 kDa and the accession number is Q9LNE6. | |||
TMPY-02805 | GNGT1 Protein, Human, Recombinant (His) | Human | E. coli |
GNGT1 is a subunit of transducin. Heterotrimeric G proteins consist of alpha, beta, and gamma subunits. They are membrane-bound GTPases that are linked to 7-TM receptors. They function as signal transducers for the 7-tra... | |||
TMPY-03400 | DCBLD1 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
Discoidin, also known as DCBLD1, contains 1 CUB domain, 1 F5/8 type C domain and 1 LCCL domain. It is a 715 amino acid single-pass membrane protein. Discoidin has a discoidin I-like domain which shares a common C-termina... | |||
TMPY-04582 | ABO Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
ABO (ABO, Alpha 1-3-N-Acetylgalactosaminyltransferase And Alpha 1-3-Galactosyltransferase) is a Protein Coding gene. Homologous glycosyltransferases α-(1→3)-N-acetylgalactosaminyltransferase (GTA) and α-(1→3)-galactosylt... | |||
TMPY-02921 | CDK2AP2 Protein, Human, Recombinant (His) | Human | E. coli |
CDK2AP2 belongs to the CDK2AP family. Members of this family of proteins are cell-growth suppressors, associating with and influencing the biological activities of important cell cycle regulators in the S phase including... | |||
TMPH-02225 | TEAD2 Protein, Human, Recombinant (His & Myc) | Human | E. coli |
Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is... | |||
TMPH-02222 | TEAD1 Protein, Human, Recombinant (His) | Human | E. coli |
Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is... | |||
TMPY-02843 | GPX7 Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
GPX7 gene contains 3 distinct gt-ag introns. Transcription produces 4 different mRNAs, 3 alternatively spliced variants, and 1 unspliced form. There are 5 validated alternative polyadenylation sites. The mRNAs appear to ... |