8-oxo-dGTP diphosphatase Protein, E. coli, Recombinant (His & SUMO)

Specifically hydrolyzes both 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to the related monophosphates, thereby cleaning up the nucleotide pools and preventing misincorporation of 8-oxoGua into DNA and RNA. It prevents replicational errors by removing an oxidatively damaged form of guanine (8-oxo-dGTP) from DNA and the nucleotide pool. 8-oxo-dGTP can be inserted opposite dA and dC residues of template DNA with almost equal efficiency thus leading to A.T to G.C transversions. MutT may also ensure transcriptional fidelity, removing 8-oxo-GTP from the ribonucleotide triphosphate pool. However, due to the lower efficiency of RNA polymerase 8-oxo-GTP incorporation, MutT is probably not a major contributor to transcriptional fidelity. It also hydrolyzes 8-oxo-dGDP and 8-oxo-GDP to their monophosphate form. In vitro, can also use dGTP, dGDP and other various nucleoside di- and triphosphates, with much lower efficiency. Works cooperatively with MutM and MutY to prevent accumulation in the DNA of oxidized guanine residues.

Pack Size	Availability	Price/USD
20 μg	20 days	$ 360.00
100 μg	20 days	$ 678.00
1 mg	20 days	$ 2,300.00

Pack Size

Availability

Price/USD

Quantity

20 μg

20 days

$ 360.00

100 μg

20 days

$ 678.00

1 mg

20 days

$ 2,300.00

Description

Species	E. coli
Expression System	E. coli
Tag	N-terminal 6xHis-SUMO-tagged
Accession Number	P08337
Synonyms	dGTP pyrophosphohydrolase, 8-oxo-dGTP diphosphatase, mutT, Mutator protein MutT, 8-oxo-dGTPase, 7,8-dihydro-8-oxoguanine-triphosphatase
Amino Acid	MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction	1-129 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	30.9 kDa (predicted)

Formulation	Tris-based buffer,50% glycerol
Reconstitution	A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage	Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shipping	In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.
Research Background	Specifically hydrolyzes both 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to the related monophosphates, thereby cleaning up the nucleotide pools and preventing misincorporation of 8-oxoGua into DNA and RNA. It prevents replicational errors by removing an oxidatively damaged form of guanine (8-oxo-dGTP) from DNA and the nucleotide pool. 8-oxo-dGTP can be inserted opposite dA and dC residues of template DNA with almost equal efficiency thus leading to A.T to G.C transversions. MutT may also ensure transcriptional fidelity, removing 8-oxo-GTP from the ribonucleotide triphosphate pool. However, due to the lower efficiency of RNA polymerase 8-oxo-GTP incorporation, MutT is probably not a major contributor to transcriptional fidelity. It also hydrolyzes 8-oxo-dGDP and 8-oxo-GDP to their monophosphate form. In vitro, can also use dGTP, dGDP and other various nucleoside di- and triphosphates, with much lower efficiency. Works cooperatively with MutM and MutY to prevent accumulation in the DNA of oxidized guanine residues.

Calculator

Reconstitution Calculator

Recombinant Proteins Dilute Calculator

Specific Activity Calculator

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

bottom

8-oxo-dGTP diphosphatase Protein, E. coli, Recombinant (His & SUMO)

Calculator

Tech Support

Keywords