Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

CGTases Protein, Paenibacillus macerans, Recombinant (His)

Catalog No. TMPH-03078

CGTases Protein, Paenibacillus macerans, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is P31835.

CGTases Protein, Paenibacillus macerans, Recombinant (His)

CGTases Protein, Paenibacillus macerans, Recombinant (His)

Catalog No. TMPH-03078
CGTases Protein, Paenibacillus macerans, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is P31835.
Pack SizePriceAvailabilityQuantity
20 μg$39720 days
100 μg$84520 days
Bulk & Custom
Add to Cart
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Questions
View More

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
CGTases Protein, Paenibacillus macerans, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.4 kDa and the accession number is P31835.
Species
Bacillus macerans
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP31835
Synonyms
Cyclomaltodextrin glucanotransferase,Cyclodextrin-glycosyltransferase (CGTase)
Amino Acid
VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN
Construction
608-713 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight13.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Sci Citations

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords