23
3
327
1
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T0805 | Quinapril hydrochloride | CI-906,PD-109452-2,Quinapril HCl | RAAS |
Quinapril hydrochloride (PD-109452-2) is an angiotensin-converting enzyme (ACE) inhibitor used in the therapy of hypertension and congestive heart failure. Quinapril hydrochloride is associated with a low rate of transie... | |||
T13865 | Resorcinolnaphthalein | RAAS | |
Resorcinolnaphthalein is a specific enhancer of angiotensin-converting enzyme 2 (ACE2) (EC50 value of 19.5 μM). | |||
T9109 | SSAA09E2 | RAAS , SARS-CoV | |
SSAA09E2 is a new SARS-CoV replication inhibitor, acting by blocking early interactions of SARS-S with the receptor for SARS-CoV, Angiotensin Converting Enzyme-2 (ACE2). | |||
T76605 | Abz-Ser-Pro-3-nitro-Tyr | ||
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) [1] . | |||
T76200 | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | ||
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1]. | |||
T83602 | (+)-Chloroquine | ||
(+)-Chloroquine, an aminoquinoline drug, inhibits the in vitro terminal glycosylation of angiotensin-converting enzyme 2 (ACE-2) [1]. | |||
T76090 | Mca-YVADAP-Lys(Dnp)-OH | ||
Mca-YVADAP-Lys(Dnp)-OH serves as a fluorogenic substrate specifically for caspase-1 and angiotensin-converting enzyme 2 (ACE2) [1]. | |||
T80048 | Mca-YVADAP-Lys(Dnp)-OH TFA | ||
Mca-YVADAP-Lys(Dnp)-OH TFA serves as a fluorogenic substrate specifically utilized for caspase-1 and angiotensin-converting enzyme 2 (ACE2) [1]. | |||
T35324 | DX600 | ||
DX600 is a useful organic compound for research related to life sciences. The catalog number is T35324 and the CAS number is 478188-26-0. | |||
T36942 | SSAA09E1 | SSAA09E1 | |
SSAA09E1 is an inhibitor of severe acute respiratory syndrome coronavirus (SARS-CoV) viral entry.1It reduces infection of HEK293T cells transiently transfected with angiotensin-converting enzyme 2 (ACE2) by an HIV-based ... | |||
T74109 | Captopril EP Impurity B | ||
Captopril EP Impurity B, a degradation product of Captopril (SQ-14534), serves as a thiol-containing, competitive inhibitor of the angiotensin-converting enzyme (ACE), demonstrating oral activity and potent antihypertens... | |||
T36622 | Angiotensin I/II (1-6) (TFA) | ||
Angiotensin I/II (1-6) TFA is a chemical compound comprising amino acids 1-6. It is derived from the Angiotensin I/II peptide, which is formed by the cleavage of the precursor angiotensinogen by renin. The resulting Angi... | |||
T80099 | Ovalbumin (154-159) | Angiotensin-converting Enzyme (ACE) | |
Ovalbumin (154-159), a peptide fragment derived from ovalbumin, acts as a potent inhibitor of the angiotensin-converting enzyme (ACE) and is utilized in hypertension research [1] [2]. | |||
T80100 | Ovotransferrin (328-332) | Angiotensin-converting Enzyme (ACE) | |
Ovotransferrin (328-332), with an IC50 of 20 μM, exhibits protective activity against hypertension by inhibiting the Angiotensin-Converting Enzyme (ACE) and also displays anti-Cholinesterase (ChE) activity, suggesting a ... | |||
T76610 | Hippuryl-His-Leu-OH | ||
Hippuryl-His-Leu-OH serves as a substrate to measure angiotensin I converting enzyme activity. Upon its cleavage, the resultant His-Leu moiety reacts with o-phthaldialdehyde or Fluorescamine, facilitating fluorescence de... | |||
T80587 | Alunacedase alfa | HrsACE2,GSK 2586881 | SARS-CoV |
Alunacedase alfa (HrsACE2; GSK 2586881), a genetically modified human recombinant soluble angiotensin-converting enzyme-2 (hrsACE2), inhibits SARS-CoV-2 cell entry by competing with membrane-bound ACE2, offering potentia... | |||
T73810 | H-Ile-Pro-Pro-OH hydrochloride | ||
H-Ile-Pro-Pro-OH hydrochloride, a tripeptide derived from milk [1], functions as an inhibitor of the angiotensin-converting enzyme (ACE) [1], demonstrating an inhibitory concentration (IC 50) of 5 μM [2]. This compound i... | |||
T75752 | N-Acetyl-Ser-Asp-Lys-Pro acetate | ||
N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate, a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE), functions as a natural inhibitor of pluripotent hematopoietic stem cell proliferatio... | |||
T60383 | Captopril hydrochloride | ||
Captopril (SQ 14225) hydrochloride is an antihypertensive agent that is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor with IC 50 of 0.025 μM and has been widely used for rese... | |||
T76613 | H-Pro-Phe-OH | ||
H-Pro-Phe-OH, a dipeptide composed of proline and phenylalanine, functions both as a substrate for prolinase and in polypeptide synthesis. Phenylalanine, an aromatic amino acid within this compound, has the capability to... | |||
T68616 | Pentoprilat | ||
Pentoprilat is a member of a series of l-glutarylindoline-2(S)-carboxylic acid derivatives. Pentopril was evaluated as an inhibitor of a cell-free preparation of angiotensin-converting enzyme (ACE) isolated from rabbit l... | |||
T60935 | H-Tyr-Phe-OH | ||
H-Tyr-Phe-OH (L-Tyrosyl-L-phenylalanine) can be used as the biomarker to distinguish benign thyroid nodules (BTN) from thyroid cancer (TC). H-Tyr-Phe-OH is an orally active Angiotensin-converting enzyme inhibitor with t... | |||
T83742 | SBP1 TFA | Spike Binding Peptide 1 | |
Spike Binding Peptide 1 (SBP1), representing amino acids 21-43 of angiotensin-converting enzyme 2 (ACE2), has been utilized in a novel approach involving lipid nanoparticles (LNPs) encapsulated with oseltamivir phosphate... |
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T3851 | Vicenin 2 | Vicenin -2 | RAAS |
Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC50=43.83 μM) from the aerial parts of Desmodium styracifolium. Vicenin 2 is an inhibitor of α-glucosidase, PTP1B, and RLAR. Vicenin 2 has hepatoprotective,... | |||
T5S0106 | Peimisine | Ebeiensine | RAAS , AChR |
1. Peimisine (Ebeiensine) can affect M-receptor, excit β-receptor, restrain the release of internal calcium, and promote to releaseing nitrogen monoxidum in order to relax tracheal smooth muscle and relieve asthma. 2. Pe... | |||
TN4860 | Pueroside B | COX , PPAR | |
Pueroside B may can treat coronary heart disease, it can interact with two or more targets[peroxisome proliferator activated receptor γ (PPAR-γ), angiotensin-converting enzyme (ACE), hydroxymethylglutaryl coenzyme A rece... |
Cat No. | Product Name | Species | Expression System |
---|---|---|---|
TMPY-02207 | ACE2/ACEH Protein, Rat, Recombinant (His) | Rat | HEK293 Cells |
ACE2/ACEH Protein, Rat, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 85 kDa and the accession number is Q5EGZ1. | |||
TMPY-03830 | ACE2/ACEH Protein, Rhesus, Recombinant (His) | Rhesus | HEK293 Cells |
ACE2/ACEH Protein, Rhesus, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 85.1 kDa and the accession number is B6DUF3. | |||
TMPY-03561 | ACE2/ACEH Protein, Rhesus, Recombinant (hFc) | Rhesus | HEK293 Cells |
ACE2/ACEH Protein, Rhesus, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 110.7kDa and the accession number is B6DUF3. | |||
TMPY-05725 | ACE2/ACEH Protein, Human, Recombinant (His & Avi), Biotinylated | Human | Baculovirus Insect Cells |
ACE2/ACEH Protein, Human, Recombinant (His & Avi), Biotinylated is expressed in Baculovirus insect cells with His and Avi tag. The predicted molecular weight is 86.86 kDa and the accession number is Q9BYF1-1. | |||
TMPY-00655 | ACE2/ACEH Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
ACE2/ACEH Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 110.3 kDa and the accession number is Q9BYF1-1. | |||
TMPY-05266 | ACE2/ACEH Protein, Human, Recombinant (His) | Human | HEK293 Cells |
ACE2/ACEH Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 85.1 kDa and the accession number is Q9BYF1-1. | |||
TMPY-05696 | ACE2/ACEH Protein, Human, Recombinant (His), Biotinylated | Human | HEK293 Cells |
ACE2/ACEH Protein, Human, Recombinant (His), Biotinylated is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 85.1 kDa and the accession number is Q9BYF1-1. | |||
TMPY-06334 | ACE2/ACEH Protein, Human, Recombinant (hFc), Biotinylated | Human | HEK293 Cells |
ACE2/ACEH Protein, Human, Recombinant (hFc), Biotinylated is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 110.3 kDa and the accession number is NP_068576.1. | |||
TMPY-04312 | ACE2/ACEH Protein, Human, Recombinant (mFc) | Human | HEK293 Cells |
ACE2/ACEH Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with mFc tag. The predicted molecular weight is 110 kDa and the accession number is Q9BYF1-1. | |||
TMPY-01838 | ACE2/ACEH Protein, Mouse, Recombinant (His) | Mouse | HEK293 Cells |
ACE2/ACEH Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 85 kDa and the accession number is Q8R0I0-1. | |||
TMPY-01839 | ACE2/ACEH Protein, Mouse, Recombinant (His & hFc) | Mouse | HEK293 Cells |
ACE2/ACEH Protein, Mouse, Recombinant (His & hFc) is expressed in HEK293 mammalian cells with His and hFc tag. The predicted molecular weight is 112 kDa and the accession number is Q8R0I0-1. | |||
TMPJ-00386 | ACE2/ACEH Protein, Human, Recombinant (HEK293, His & Avi), Biotinylated | Human | HEK293 Cells |
Angiotensin-Converting Enzyme 2 (ACE-2) is an integral membrane protein and a zinc metalloprotease of the ACE family, the ACE family includes somatic and germinal ACE. ACE-2 cleaves angiotensins I and II as a carboxypept... | |||
TMPH-03081 | ACE2 Protein, Paguma larvata, Recombinant (hFc) | Paguma larvata | HEK293 Cells |
ACE2 Protein, Paguma larvata, Recombinant (hFc) is expressed in HEK293 mammalian cells with C-hFc tag. The predicted molecular weight is 112.7 kDa and the accession number is Q56NL1. | |||
TMPK-00383 | ACE2/ACEH Protein, Human, Recombinant (His & Avi) | Human | HEK293 Cells |
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio... | |||
TMPK-00552 | ACE2/ACEH Protein, Cynomolgus, Recombinant (His & Avi), Biotinylated | Cynomolgus | HEK293 Cells |
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio... | |||
TMPK-00382 | ACE2/ACEH Protein, Human, Recombinant (hFc & Avi), Biotinylated | Human | HEK293 Cells |
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio... | |||
TMPK-00551 | ACE2/ACEH Protein, Cynomolgus, Recombinant (His & Avi) | Cynomolgus | HEK293 Cells |
ACE2 (Angiotensin I Converting Enzyme 2) is a Protein Coding gene. Diseases associated with ACE2 include Severe Acute Respiratory Syndrome and Neurogenic Hypertension.The protein encoded by this gene belongs to the angio... | |||
TMPK-00439 | SARS-COV-2 Spike RBD Protein (His & Avi), Biotinylated | SARS-CoV-2 | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00434 | SARS-COV-2 Spike RBD Protein (hFc & Avi), Biotinylated | SARS-CoV-2 | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00433 | SARS-COV-2 Spike S1 Protein (hFc & Avi), Biotinylated | SARS-CoV-2 | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00913 | SARS Spike S1 Protein (His & Avi), Biotinylated | SARS | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00908 | SARS Spike S1 Protein (hFc & Avi) | SARS | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00440 | SARS-COV-2 Spike S1 Protein (His & Avi), Biotinylated | SARS-CoV-2 | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00437 | SARS-COV-2 Spike RBD Protein (His & Avi) | SARS-CoV-2 | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00432 | SARS-COV-2 Spike S1 Protein (hFc & Avi) | SARS-CoV-2 | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00441 | SARS-COV-2 Spike S Trimer Protein (His & Avi), Biotinylated | SARS-CoV-2 | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00442 | SARS-COV-2 (Omicron B.1.1.529) Spike S Trimer Protein (His & Avi), Biotinylated | SARS-CoV-2 | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00910 | SARS Spike S1 Protein (His & Avi) | SARS | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00912 | SARS Spike RBD Protein (His & Avi), Biotinylated | SARS | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00909 | SARS Spike S1 Protein (hFc & Avi), Biotinylated | SARS | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00438 | SARS-COV-2 Spike S Trimer Protein (His & Avi) | SARS-CoV-2 | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00444 | SARS-COV-2 Spike S1 NTD Protein (His & Flag) | SARS-CoV-2 | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00443 | SARS-COV-2 (Omicron B.1.1.529) Spike S1 Protein (His & Avi), Biotinylated | SARS-CoV-2 | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPK-00911 | SARS Spike RBD Protein (His & Avi) | SARS | HEK293 Cells |
The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays k... | |||
TMPY-06885 | SARS-CoV-2 XBB.1.16 (Omicron) Spike S1+S2 trimer Protein (ECD, His) | ||
The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4;... | |||
TMPY-04116 | KRAS Protein,Human,Recombinant(G12C & Q61H, His) | Human | E. coli |
KRAS Protein,Human,Recombinant(G12C & Q61H, His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 23.3 kDa and the accession number is P01116-2. | |||
TMPY-01691 | Clusterin Protein, Human, Recombinant (CLU34, His) | Human | HEK293 Cells |
Clusterin Protein, Human, Recombinant (CLU34, His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 51.5 kDa and the accession number is P10909-2. | |||
TMPY-00891 | Neuropilin-1 Protein, Human, Recombinant (V179A, hFc) | Human | HEK293 Cells |
Neuropilin-1 Protein, Human, Recombinant (V179A, hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 96.5 kDa and the accession number is O14786-2. | |||
TMPY-00850 | ST2/IL-1 RL1 Protein, Human, Recombinant | Human | HEK293 Cells |
ST2/IL-1 RL1 Protein, Human, Recombinant is expressed in HEK293 mammalian cells. The predicted molecular weight is 35.6 kDa and the accession number is Q01638-2. | |||
TMPY-00849 | ST2/IL-1 RL1 Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
ST2/IL-1 RL1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 61.72 kDa and the accession number is Q01638-2. | |||
TMPY-02792 | GDNF Protein, Human, Recombinant (HEK293) | Human | HEK293 Cells |
GDNF Protein, Human, Recombinant (HEK293) is expressed in HEK293 mammalian cells. The predicted molecular weight is 15.1 kDa and the accession number is P39905-2. | |||
TMPY-02011 | CD96 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
CD96 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 55 kDa and the accession number is P40200-2. | |||
TMPY-00005 | FGF-8a Protein, Human, Recombinant | Human | E. coli |
In mammalian embryos, transient Fgf8 expression defines the developing isthmic region, lying between the midbrain and the first rhombomere, but there has been uncertainty about the existence of a distinct isthmic segment... | |||
TMPY-05288 | PLGF/PGF Protein, Human, Recombinant (aa 19-149) | Human | E. coli |
PLGF/PGF Protein, Human, Recombinant (aa 19-149) is expressed in E. coli expression system. The predicted molecular weight is 14.9 kDa and the accession number is P49763-2. | |||
TMPY-00871 | LAYN Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
LAYN Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 49.5 kDa and the accession number is Q6UX15-2. | |||
TMPY-02358 | CD98 Protein, Mouse, Recombinant (His) | Mouse | HEK293 Cells |
CD98 Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 49.2 kDa and the accession number is P10852-2. | |||
TMPY-00748 | Nectin-2 Protein, Human, Recombinant | Human | HEK293 Cells |
Nectin-2 Protein, Human, Recombinant is expressed in HEK293 mammalian cells. The predicted molecular weight is 36.2 kDa and the accession number is Q92692-2. | |||
TMPY-00341 | FGFR3 Protein, Human, Recombinant (alpha IIIb, His) | Human | HEK293 Cells |
FGFR3 Protein, Human, Recombinant (alpha IIIb, His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 40 kDa and the accession number is P22607-2. | |||
TMPY-04396 | C-ABL/ABL1 Protein, Human, Recombinant (GST) | Human | Baculovirus Insect Cells |
c-Abl belongs to the class of tyrosine kinases and is the prototype of a subfamily which includes two members, c-Abl and Arg (Abl-related gene). Both proteins are localized at the cell membrane, actin cytoskeleton and cy... | |||
TMPY-01935 | C-Kit Protein, Human, Recombinant (His) | Human | HEK293 Cells |
c-Kit Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 56.7 kDa and the accession number is P10721-2. | |||
------------------------ More ------------------------ |
Cat No. | Product Name | ||
---|---|---|---|
L7110 | Anti-Hypertension Compound Library | 678 compounds | |
678 hypertension-related small molecules for high-throughput and high-content screening. |