eae — TargetMol Chemicals

Cat No.	Product Name	Synonyms	Targets
T12079	ML604440		Proteasome
	ML604440 is a cell permeable proteasome β1i (LMP2) subunit inhibitor.		Proteasome
T4031	S1p receptor agonist 1	S1p-receptor-agonist-1	S1P Receptor , LPL Receptor
	S1p receptor agonist 1 (S1p-receptor-agonist-1) is an S1P receptor agonist.		S1P Receptor , LPL Receptor
T14055	5Z-7-Oxozeaenol	FR148083,L783279,LL-Z 1640-2	VEGFR , FLT , MEK , MAPK , PDGFR , Antibiotic , Src
	5Z-7-Oxozeaenol (FR148083) is a potent, irreversible and selective inhibitor of transforming growth factor (TGF)-β-activated kinase 1 with IC50 of 8.1 nM for TAK1 and low activity against MEK1 with IC50 of 411 nM, it is ...		VEGFR , FLT , MEK , MAPK , PDGFR , Antibiotic , Src
T76200	STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
	STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1].
T35438	(5E)-7-Oxozeaenol
	(5E)-7-Oxozeaenol is a resorcylic acid lactone that has been found in the fungus MSX 63935 and has enzyme inhibitory and anticancer activities.1,2 It inhibits TGF-β-activated kinase 1 (TAK-1; IC50 = 1.3 μM).1 (5E)-7-Oxoz...
T3426	Bacoside A		MMP , Others , TNF , Dopamine Receptor , NOS , ROS
	Bacoside A has a possible anticancer activity that could be inducing cell cycle arrest and apoptosis through Notch pathway in GBM in vitro. It exerts cytoprotective efficacy by attenuation of ROS generated through oxidat...		MMP , Others , TNF , Dopamine Receptor , NOS , ROS
T33514	MSC 2032964A	MSC-2032964A,MSC2032964A	ASK
	MSC 2032964A is a potent selective ASK1 inhibitor (IC50 = 93 nM) that is oral bioavailable and brain permeable. It inhibited neuroinflammation in mouse EAE models and blocked LPS-induced phosphorylation of ASK1 and p38 i...		ASK
T14924	Cenerimod	ACT-334441	S1P Receptor
	Cenerimod (ACT-334441) is an orally active, selective, and potent sphingosine 1-phosphate receptor (S1P1) agonist (EC50: 1 nM).Cenerimod inhibits multiple S1P isoforms and can be used to study murine experimental autoimm...		S1P Receptor
T3701	MCC950	CP-456773	NOD
	CP-456773 (MCC950 (CP-456773) and CRID3) is an effective and specific cytokine release inhibitor and NLRP3 inflammasome inhibitor. CP-456773 inhibits IL-1β secretion and caspase 1 processing. MCC950 blocked canonical and...		NOD
T7657L	MOG peptide (35-55) , mouse, rat acetate	Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat acetate,MOG peptide (35-55) , mouse, rat acetate (149635-73-4 Free base)	Others
	Myelin Oligodendrocyte Glycoprotein (MOG) peptide (35-55) , mouse, rat acetate is a MOG peptide (35-55) derivative. MOG peptide (35-55) is a part of myelin oligodendrocyte glycoprotein (MOG) immunogenic peptide and can b...		Others
T81734	Myelin Basic Protein (1-11)
	Myelin Basic Protein (1-11), an encephalitogenic epitope of MBP, facilitates the induction of experimental autoimmune encephalomyelitis (EAE) [1] [2].
T68408	AMG-1
	AMG-1 is a specific CRAC channel inhibitor. AMG-1 blocks the function of effector T cells, but not regulatory T cells in vitro and it attenuates the progression and severity of EAE in vivo.
T82424	Experimental allergic encephalitogenic peptide (human)
	Experimental allergic encephalitogenic peptide (human), an EAE peptide, induces encephalomyelitis in guinea pigs [1].
T63206	SR12418
	SR12418 is a specific REV-ERB synthetic ligand that acts on REV-ERBα (IC50: 68 nM) and REV-ERBβ (IC50: 119 nM) and can be used to study experimental autoimmune encephalomyelitis (EAE) and colitis.
TP1282	PLP (139-151)	PLP 139-151
	PLP (139-151) is amino acid residue residue 139 to 151 of myelin proteolipid protein (PLP). This peptide is used to induce relapsing-remitting (RR)-EAE model.
T30529	BMS-520
	BMS-520 is a potent, selective S1P1 agonist that has shown impressive efficacy when administered orally in a rat model of arthritis and in a mouse model of experimental autoimmune encephalomyelitis (EAE) with multiple sc...
T78492	D-Mannuronic acid sodium
	Sodium D-mannuronate, derived from the seaweed Macrocystis pyrifera, shows promise as a therapeutic agent in studies of autoimmune encephalomyelitis (EAE), adjuvant-induced arthritis (AIA), nephrotic syndrome, and acute ...
T78031	MOG peptide (35-55)
	MOG peptide (35-55), a myelin oligodendrocyte glycoprotein (MOG) fragment spanning amino acids 35 to 55, selectively stimulates CD4+ T cell expansion and induces experimental autoimmune encephalomyelitis (EAE) in animal ...
T82020	J5 peptide	Myelin basic protein (85-99) antagonist
	J5 peptide, an MBP inhibitor, competitively inhibits the binding of MBP 85-99 to HLA-DR2, and mitigates PLP 139-151/MBP 85-99-induced experimental autoimmune encephalomyelitis (EAE) in mice. It is utilized in research pe...
T82621	D359-0396		NOD-like Receptor (NLR)
	D359-0396 is an orally active NLRP3 inflammasome inhibitor that mitigates pyroptosis and reduces IL-1β release in macrophages by inhibiting the oligomerization of NLRP3, ASC, and the cleavage of GSDMD. This compound is e...		NOD-like Receptor (NLR)