α2δ — TargetMol Chemicals

Cat No.	Product Name	Synonyms	Targets
T3377	L-Phenylalanine	(S)-2-Amino-3-phenylpropionic acid,phenylalanine,3-Phenyl-L-alanine	Calcium Channel , Endogenous Metabolite , iGluR
	L-Phenylalanine (3-Phenyl-L-alanine) is an essential amino acid and the precursor of the amino acid tyrosine, acts as an antagonist at α2δ calcium channels.		Calcium Channel , Endogenous Metabolite , iGluR
T72701	Cavα2δ1&NET-IN-3
	Cavα2δ1&NET-IN-3 (example 216) is an inhibitor targeting both the α2δ subunit of voltage-gated calcium channels (VGCC) and the noradrenaline transporter (NET). It exhibits inhibitory constants (Ki) ranging from 100 to 50...
T72700	Cavα2δ1&NET-IN-2
	Cavα2δ1&NET-IN-2 . Cavα2δ1&NET-IN-2 inhibits Ca v α2δ-1 with a K i of 454 nM. Cavα2δ1&NET-IN-2 inhibits NET with a K i of 59 nM and IC 50 of 7 nM. Cavα2δ1&NET-IN-2 can be used for research of pain .
T72699	Cavα2δ1&NET-IN-1
	Cavα2δ1&NET-IN-1 . Cavα2δ1&NET-IN-1 inhibits Ca v α2δ-1 with a K i of 112 nM. Cavα2δ1&NET-IN-1 inhibits NET with a K i of 383 nM and IC 50 of 67 nM. Cavα2δ1&NET-IN-1 can be used for research of pain .
T40071	Cavα2δ-IN-1
	Cavα2δ-IN-1 demonstrates exceptional specificity for voltage-gated calcium channels Cavα2δ-1 (with a Ki value of 6 nM), in comparison to Cavα2δ-2 (with a Ki value greater than 10,000 nM).
T68125L	PD 0299685	PF-299685,PD-299,685	Calcium Channel
	PD 0299685 is a potent α2δ ligand of the Ca2+ channel for the treatment of interstitial cystitis.		Calcium Channel
T30188L	Atagabalin HCl	PD-0200390 HCl,Atagabalin HCl(223445-75-8 Free base）	Calcium Channel
	Atagabalin HCl is a novel voltage-dependent calcium channel (VDCC) α2δ subunit (1 and 2) ligand that affects slow-wave sleep and can be used to treat insomnia.		Calcium Channel
T7216	Mirogabalin	DS5565	Calcium Channel
	Mirogabalin (DS5565) is a calcium channel blocker with analgesic effects.		Calcium Channel
T77642	1-(aminomethyl)cyclopropanecarboxylic acid hydrochloride		Calcium Channel
	1-(aminomethyl)cyclopropanecarboxylic acid hydrochloride inhibits L amino acid transporter proteins and the α2δ subunit of voltage-gated calcium channels.1-(aminomethyl)cyclopropanecarboxylic acid hydrochloride can be us...		Calcium Channel
T8639	Phenibut (hydrochloride)	3-Amino-4-phenylbutyric acid hydrochloride	GABA Receptor
	Phenibut hydrochloride (3-Amino-4-phenylbutyric acid hydrochloride) is a GABA mimetic that acts as an agonist at GABAB receptors, blocks α2δ subunit-containing voltage-gated calcium channels, stimulates dopamine receptor...		GABA Receptor
T40376	L-Phenylalanine-15N	(S)-2-Amino-3-phenylpropionic acid-15N,L-Phenylalanine-15N	Calcium Channel
	L-Phenylalanine-15N ((S)-2-Amino-3-phenylpropionic acid-15N) is the 15N-labeled L-Phenylalanine. L-Phenylalanine is an essential amino acid isolated from Escherichia coli . L-Phenylalanine is a α2δ subunit of voltage-dep...		Calcium Channel
T6507	Gabapentin hydrochloride	Neurontin HCl,Gabapentin HCl	Calcium Channel , GABA Receptor
	Gabapentin hydrochloride (Neurontin HCl) is a GABA analogue, used to treat seizures and neuropathic pain.		Calcium Channel , GABA Receptor
T76250	VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
	VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of α2δ-1 and is recognized as the α2δ-1Tat peptide. It disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, offering a p...
T76250L	VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
	VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, demonstrati...
T61434	Mirogabalin besylate
	Mirogabalin besylate is a potent and orally active ligand that selectively targets the α2δ subunit of voltage-gated calcium channels. It displays high affinity (K d ) values, namely 13.5 nM, 22.7 nM, 27 nM, and 47.6 nM, ...
T16447	β-Amino Acid Imagabalin Hydrochloride	PD-0332334	Calcium Channel
	β-Amino Acid Imagabalin Hydrochloride is the voltage-dependent calcium channel ligand for the α2δ subunit.		Calcium Channel
T23769	AZSMO-23	AZSMO 23
	AZSMO-23 is the human ether-a-go-go-related gene (hERG)-encoded potassium channel activator that acts by blocking hKv4.3-hKChIP2.2, hCav3.2, and hKv1.5 and activating hCav1.2/β2/α2δ.
T30188	Atagabalin	PD 0200390,PD-0200390,PD0200390
	Atagabalin, also known as PD 0200390, is a gabamimetic agent under development for the treatment for insomnia. Atagabalin is related to gabapentin, which similarly binds to the α2δ calcium channels (1 and 2). It was disc...
T60252	HSK16149
	HSK16149 is a novel ligand of voltage-gated calcium channel (VGCC) α 2 δ subunit with analgesic activity.