keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, demonstrating potential utility in neuropathic pain research [1].
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
5 mg | Inquiry | Inquiry | |
50 mg | Inquiry | Inquiry |
Description | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, demonstrating potential utility in neuropathic pain research [1]. |
Molecular Weight | 3604.08 |
Formula | C173H251F3N40O41 |
keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
You can also refer to dose conversion for different animals. More
bottom
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc.
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA inhibitor inhibit