Shopping Cart
- Remove All
 
Your shopping cart is currently empty
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, demonstrating potential utility in neuropathic pain research [1].
| Pack Size | Price | Availability | Quantity | 
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder | 
| Description | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, demonstrating potential utility in neuropathic pain research [1].  | 
| Molecular Weight | 3604.08 | 
| Formula | C173H251F3N40O41 | 
| Sequence Short | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW | 
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | 

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.