keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of α2δ-1 and is recognized as the α2δ-1Tat peptide. It disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, offering a potential research tool for neuropathic pain studies [1].
Pack Size | Availability | Price/USD | Quantity |
---|---|---|---|
5 mg | Inquiry | Inquiry | |
50 mg | Inquiry | Inquiry |
Description | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of α2δ-1 and is recognized as the α2δ-1Tat peptide. It disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, offering a potential research tool for neuropathic pain studies [1]. |
Molecular Weight | 3490.06 |
Formula | C171H250N40O39 |
CAS No. | 2279952-25-7 |
keep away from moisture
Powder: -20°C for 3 years | In solvent: -80°C for 1 year
You can also refer to dose conversion for different animals. More
bottom
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc.
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW 2279952-25-7 inhibitor inhibit