17
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T3377 | L-Phenylalanine | (S)-2-Amino-3-phenylpropionic acid,phenylalanine,3-Phenyl-L-alanine | Calcium Channel , Endogenous Metabolite , iGluR |
L-Phenylalanine (3-Phenyl-L-alanine) is an essential amino acid and the precursor of the amino acid tyrosine, acts as an antagonist at α2δ calcium channels. | |||
T72701 | Cavα2δ1&NET-IN-3 | Others | |
Cavα2δ1&NET-IN-3 (example 216) is an inhibitor targeting both the α2δ subunit of voltage-gated calcium channels (VGCC) and the noradrenaline transporter (NET). It exhibits inhibitory constants (Ki) ranging from 100 to 50... | |||
T72700 | Cavα2δ1&NET-IN-2 | Others | |
Cavα2δ1&NET-IN-2 . Cavα2δ1&NET-IN-2 inhibits Ca v α2δ-1 with a K i of 454 nM. Cavα2δ1&NET-IN-2 inhibits NET with a K i of 59 nM and IC 50 of 7 nM. Cavα2δ1&NET-IN-2 can be used for research of pain . | |||
T72699 | Cavα2δ1&NET-IN-1 | Others | |
Cavα2δ1&NET-IN-1 . Cavα2δ1&NET-IN-1 inhibits Ca v α2δ-1 with a K i of 112 nM. Cavα2δ1&NET-IN-1 inhibits NET with a K i of 383 nM and IC 50 of 67 nM. Cavα2δ1&NET-IN-1 can be used for research of pain . | |||
T40071 | Cavα2δ-IN-1 | Others | |
Cavα2δ-IN-1 demonstrates exceptional specificity for voltage-gated calcium channels Cavα2δ-1 (with a Ki value of 6 nM), in comparison to Cavα2δ-2 (with a Ki value greater than 10,000 nM). | |||
T68125L | PD 0299685 | PF-299685,PD-299,685 | Calcium Channel |
PD 0299685 is a potent α2δ ligand of the Ca2+ channel for the treatment of interstitial cystitis. | |||
T7216 | Mirogabalin | DS5565 | Calcium Channel |
Mirogabalin (DS5565) is a calcium channel blocker with analgesic effects. | |||
T30188L | Atagabalin HCl | PD-0200390 HCl,Atagabalin HCl(223445-75-8 Free base) | Calcium Channel |
Atagabalin HCl is a novel voltage-dependent calcium channel (VDCC) α2δ subunit (1 and 2) ligand that affects slow-wave sleep and can be used to treat insomnia. | |||
T77642 | 1-(aminomethyl)cyclopropanecarboxylic acid hydrochloride | Calcium Channel | |
1-(aminomethyl)cyclopropanecarboxylic acid hydrochloride inhibits L amino acid transporter proteins and the α2δ subunit of voltage-gated calcium channels.1-(aminomethyl)cyclopropanecarboxylic acid hydrochloride can be us... | |||
T8639 | Phenibut (hydrochloride) | 3-Amino-4-phenylbutyric acid hydrochloride | GABA Receptor |
Phenibut hydrochloride (3-Amino-4-phenylbutyric acid hydrochloride) is a GABA mimetic that acts as an agonist at GABAB receptors, blocks α2δ subunit-containing voltage-gated calcium channels, stimulates dopamine receptor... | |||
T61434 | Mirogabalin besylate | Others | |
Mirogabalin besylate is a potent and orally active ligand that selectively targets the α2δ subunit of voltage-gated calcium channels. It displays high affinity (K d ) values, namely 13.5 nM, 22.7 nM, 27 nM, and 47.6 nM, ... | |||
T76250 | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW | ||
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of α2δ-1 and is recognized as the α2δ-1Tat peptide. It disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, offering a p... | |||
T76250L | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA | ||
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, demonstrati... | |||
T16447 | β-Amino Acid Imagabalin Hydrochloride | PD-0332334 | Calcium Channel |
β-Amino Acid Imagabalin Hydrochloride is the voltage-dependent calcium channel ligand for the α2δ subunit. | |||
T23769 | AZSMO-23 | AZSMO 23 | Others |
AZSMO-23 is the human ether-a-go-go-related gene (hERG)-encoded potassium channel activator that acts by blocking hKv4.3-hKChIP2.2, hCav3.2, and hKv1.5 and activating hCav1.2/β2/α2δ. | |||
T30188 | Atagabalin | PD 0200390,PD-0200390,PD0200390 | Others |
Atagabalin, also known as PD 0200390, is a gabamimetic agent under development for the treatment for insomnia. Atagabalin is related to gabapentin, which similarly binds to the α2δ calcium channels (1 and 2). It was disc... | |||
T60252 | HSK16149 | Others | |
HSK16149 is a novel ligand of voltage-gated calcium channel (VGCC) α 2 δ subunit with analgesic activity. |