ldk — TargetMol Chemicals

Cat No.	Product Name	Synonyms	Targets
T24398	Lenaldekar	LDK	Akt , IGF-1R , S6 Kinase
	Lenaldekar (LDK) inhibits T-cell expansion and autoimmune encephalomyelitis. Lenaldekar causes dephosphorylation of members of the PI3 kinase/AKT/mTOR pathway and delays sensitive cells in late mitosis.		Akt , IGF-1R , S6 Kinase
T1791L	Ceritinib dihydrochloride	LDK378 dihydrochloride	IGF-1R , ALK
	Ceritinib dihydrochloride (LDK378 dihydrochloride) is a selective, orally bioavailable and ATP-competitive inhibitor of ALK tyrosine kinase(IC50 of 200 pM), and also inhibits IGF-1R, InsR, and STK22D (IC50 values of 8, 7...		IGF-1R , ALK
T1791	Ceritinib	LDK378	Serine Protease , IGF-1R , ALK
	Ceritinib (LDK378) is a specific ALK inhibitor (IC50: 0.2 nM).		Serine Protease , IGF-1R , ALK
T82482	ELDKWA
	ELDKWA, a highly conserved sequence of amino acids located on the ecto-domain of gp41, serves as the epitope for mAb 2F5, a neutralizing monoclonal antibody against human immunodeficiency virus type 1 [1] [2].
T76200	STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
	STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1].