5
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T24398 | Lenaldekar | LDK | Akt , IGF-1R , S6 Kinase |
Lenaldekar (LDK) inhibits T-cell expansion and autoimmune encephalomyelitis. Lenaldekar causes dephosphorylation of members of the PI3 kinase/AKT/mTOR pathway and delays sensitive cells in late mitosis. | |||
T1791L | Ceritinib dihydrochloride | LDK378 dihydrochloride | IGF-1R , ALK |
Ceritinib dihydrochloride (LDK378 dihydrochloride) is a selective, orally bioavailable and ATP-competitive inhibitor of ALK tyrosine kinase(IC50 of 200 pM), and also inhibits IGF-1R, InsR, and STK22D (IC50 values of 8, 7... | |||
T1791 | Ceritinib | LDK378 | Serine Protease , IGF-1R , ALK |
Ceritinib (LDK378) is a specific ALK inhibitor (IC50: 0.2 nM). | |||
T82482 | ELDKWA | ||
ELDKWA, a highly conserved sequence of amino acids located on the ecto-domain of gp41, serves as the epitope for mAb 2F5, a neutralizing monoclonal antibody against human immunodeficiency virus type 1 [1] [2]. | |||
T76200 | STIEEQAKTFLDKFNHEAEDLFYQSSLASWN | ||
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, a peptide related to angiotensin-converting enzyme 2 (ACE2), is utilized in research to examine ACE2's function [1]. |