fts — TargetMol Chemicals

Cat No.	Product Name	Synonyms	Targets
T6163	Salirasib	Farnesyl Thiosalicylic Acid,S-Farnesylthiosalicylic acid,FTS	Autophagy , Ras
	Salirasib (Farnesyl Thiosalicylic Acid)(Ki=2.6 μM), an effective competitive prenylated protein methyltransferase (PPMTase) inhibitor, inhibits Ras methylation with potential antineoplastic activity.		Autophagy , Ras
TP1388	HAEGTFTSDVSSYLE		Others
	HAEGTFTSDVSSYLE is a peptide. GLP-I analog contains the sequence.		Others
TP1382L	HAEGTFTSDVS acetate	HAEGTFTSDVS acetate(864915-61-7 free base)	Glucagon Receptor
	HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.		Glucagon Receptor
T8811	Tuftsin 3TFA		Endogenous Metabolite
	Tuftsin 3TFA is a tetrapeptide. It is a macrophage/microglial activator.		Endogenous Metabolite
T7630	Tuftsin	Tuftsin(3TFA)	Endogenous Metabolite
	Tuftsin (Tuftsin(3TFA)) is a natural activator of Phagocyte Cells		Endogenous Metabolite
T74790	FtsZ-IN-7
	FtsZ-IN-7 is a potent inhibitor of FtsZ, enhancing FtsZ polymerization while inhibiting its GTPase activity, therefore disrupting bacterial cell division and culminating in bacterial cell death. It exhibits bactericidal ...
T75860	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
T81558	P-Aminophenylacetyl-tuftsin
	p-Aminophenylacetyl-tuftsin is an active synthetic peptide utilized in the research of multiple diseases [1].
T75859	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
T61737	FtsZ-IN-4
	FtsZ-IN-4, an orally active inhibitor of FtsZ (filamenting temperature-sensitive mutant Z), demonstrates remarkable antibacterial activity and favorable pharmaceutical properties. With low cytotoxicity (CC 50 >20 μg/mL) ...
T74788	FtsZ-IN-5
	FtsZ-IN-5 is a potent inhibitor of FtsZ, promoting polymerization while inhibiting its GTPase activity, thereby preventing bacterial division and leading to cell death. It exhibits bactericidal activity without significa...
TP1382	HAEGTFTSDVS
	HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.
TP1846	Tuftsin diacetate
	Tuftsin diacetate, a tetrapeptide, is a macrophage/microglial activator. Tuftsin is a tetrapeptide, Thr-Lys-Pro-Arg, which resides in the Fc-domain of the heavy chain of immunoglobulin G. Tuftsin possesses a broad spectr...
TP1452	HAEGTFTSD
	HAEGTFTSD is the first N-terminal 1-9 residues of GLP-1 peptide.The GLP-1 (7-36) amide is a product of the preproglucagon gene, which is secreted from intestinal L-cells, in response to the ingestion of food.
T34964	Tuftsin, lys(4)-	4-Lys-tuftsin,Tuftsin, lysine(4)-
	Tuftsin, lys(4)- is a bioactive chemical.
T34965	Tuftsin-M	Tuftsin M
	Tuftsin-M induces respiratory can burst in peritoneal exudate cells.
T74789	FtsZ-IN-6
	FtsZ-IN-6 is a potent inhibitor of FtsZ, enhancing its polymerization while inhibiting its GTPase activity, thereby obstructing bacterial cell division and causing bacterial cell death. This compound exhibits bactericida...
T74791	FtsZ-IN-8
	FtsZ-IN-8, a potent inhibitor of FtsZ, both promotes FtsZ polymerization and inhibits its GTPase activity, leading to the inhibition of bacterial division and subsequent bacterial cell death. This compound exhibits bacte...
TP1452L1	HAEGTFTSD acetate(926018-45-3 free base)		Glucagon Receptor
	HAEGTFTSD acetate is the first N-terminal 1-9 residues of GLP-1 peptide.The GLP-1 (7-36) amide is a product of the preproglucagon gene, which is secreted from intestinal L-cells, in response to the ingestion of food.		Glucagon Receptor
T63552	FtsZ-IN-1
	FtsZ-IN-1 is a potent FtsZ inhibitor with a quinoline ring and has a strong inhibitory effect on Gram-positive bacteria (MIC: 0.5-8 μg/mL).FtsZ-IN-1 enhances FtsZ polymerization and significantly promotes cell elongation...