20
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T13570 | Benzamide Derivative 1 | Others | |
Benzamide Derivative 1 Benzamide derivative with gastrokinetic activity.Benzamide Derivative 1 can be used in the study of gastrointestinal diseases. | |||
T11550 | Helioxanthin derivative 5-4-2 | Helioxanthin 5-4-2 | HBV |
Helioxanthin derivative 5-4-2 (Helioxanthin 5-4-2) is an analogue of helioxanthin that shows anti-HBV activity in vitro and can be used to study HBV. | |||
T13751 | L-Threonine derivative-1 | Others | |
L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity. | |||
T11421 | Glutaminase-IN-1 | CB839 derivative | transporter |
Glutaminase-IN-1 (CB839 derivative), a novel 1,3,4-selenodiazepine renal-type glutaminase (KGA) variant inhibitor, showed antitumor activity in an aggressive H22 hepatocellular carcinoma xenograft model. | |||
T38506 | Cis-Clopidogrel-MP derivative | cis-Clopidogrel-MP derivative,Clopidogrel-MP-AM | |
cis-Clopidogrel-MP derivative, also known as Clopidogrel-MP-AM, is a 3’-methoxyacetophenone derivative of Clopidogrel active metabolite. This compound is an orally-active platelet inhibitor specifically targeting the P2Y... | |||
T12717 | Basimglurant | CTEP Derivative,RG7090 | GluR |
Basimglurant (CTEP Derivative) is a potent, selective and orally available modulator of mGlu5 negative allosteric(Kd of 1.1 nM). | |||
TP1154 | Exendin-4 peptide derivative acetate | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS,Exendin-4 peptide derivative | |
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative. | |||
T39320 | Hemiasterlin derivative-1 | ||
Hemiasterlin Derivative-1, a derivative of hemiasterlin, is utilized in the synthesis of Antibody-Drug Conjugates (ADC). | |||
T40328 | Betulinic acid derivative-1 | ||
Betulinic acid derivative-1 demonstrates potent inhibition of osteoclast (OC) differentiation, achieving an IC50 value of 1.86 μM. | |||
T19296 | DOTA derivative | Others | |
DOTA derivatives are phenoxy derivatives of cyclic Tosamide;Direct nitrification;It is more convenient to add nitro group after removing the protection of lithium aluminium hydride. | |||
TP1392 | Exendin derivative 1 | ||
Exendin derivative 1 is a 39 amino acid peptide. | |||
T13853 | Pyridazinediones-derivative-1 | Others | |
Pyridazinediones-derivative-1 has potential in treating neurodegenerative disorders. | |||
T26397 | 6PGD-IN-S3 | 6PGD Inhibitor S3,S3,Danthron methyl derivative | Dehydrogenase |
6PGD-IN-S3 (6PGD Inhibitor S3) is an inhibitor of 6-phosphogluconate dehydrogenase (6PGD). | |||
T11249L | Dxd | Exatecan derivative for ADC,OQM5SD32BQ,UNII-OQM5SD32BQ | Topoisomerase |
Dxd (OQM5SD32BQ) is a potent inhibitor of DNA topoisomerase I with an IC50 of 0.31 μM. It is used as a conjugated drug of HER2-targeting ADC. | |||
T10106 | 3-arylisoquinolinamine derivative | Others | |
3-arylisoquinolinamine derivative is a compound with antitumor activity. | |||
T11654 | Indirubin Derivative E804 | Others | |
Indirubin Derivative E804 is an effective inhibitor of IGF1R, which has an IC50 value of 0.65. | |||
T13662 | Diarylalkane derivative 1 | Others | |
Diarylalkane derivative 1 is used for the research of pancreatitis. | |||
T19534 | Glycerol derivative 1 | Others | |
Glycerol derivative 1 is a Glycerol derivative. | |||
T12333 | OT antagonist 1 demethyl derivative | Others | |
OT antagonist 1 demethyl derivative is the demethyl derivative of OT antagonist 1. OT antagonist 1 is a selective Oxytocin antagonist (Ki of 50 nM. ) | |||
TP1161 | Exendin-4 peptide derivative | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | |
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. |