Home Tools
Log in
Cart

Search Result

Search Results for " derivative "

20

Compounds

Cat No. Product Name Synonyms Targets
T13570 Benzamide Derivative 1 Others
Benzamide Derivative 1 Benzamide derivative with gastrokinetic activity.Benzamide Derivative 1 can be used in the study of gastrointestinal diseases.
T11550 Helioxanthin derivative 5-4-2 Helioxanthin 5-4-2 HBV
Helioxanthin derivative 5-4-2 (Helioxanthin 5-4-2) is an analogue of helioxanthin that shows anti-HBV activity in vitro and can be used to study HBV.
T13751 L-Threonine derivative-1 Others
L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity.
T11421 Glutaminase-IN-1 CB839 derivative transporter
Glutaminase-IN-1 (CB839 derivative), a novel 1,3,4-selenodiazepine renal-type glutaminase (KGA) variant inhibitor, showed antitumor activity in an aggressive H22 hepatocellular carcinoma xenograft model.
T38506 Cis-Clopidogrel-MP derivative cis-Clopidogrel-MP derivative,Clopidogrel-MP-AM
cis-Clopidogrel-MP derivative, also known as Clopidogrel-MP-AM, is a 3’-methoxyacetophenone derivative of Clopidogrel active metabolite. This compound is an orally-active platelet inhibitor specifically targeting the P2Y...
T12717 Basimglurant CTEP Derivative,RG7090 GluR
Basimglurant (CTEP Derivative) is a potent, selective and orally available modulator of mGlu5 negative allosteric(Kd of 1.1 nM).
TP1154 Exendin-4 peptide derivative acetate GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS,Exendin-4 peptide derivative
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.
T39320 Hemiasterlin derivative-1
Hemiasterlin Derivative-1, a derivative of hemiasterlin, is utilized in the synthesis of Antibody-Drug Conjugates (ADC).
T40328 Betulinic acid derivative-1
Betulinic acid derivative-1 demonstrates potent inhibition of osteoclast (OC) differentiation, achieving an IC50 value of 1.86 μM.
T19296 DOTA derivative Others
DOTA derivatives are phenoxy derivatives of cyclic Tosamide;Direct nitrification;It is more convenient to add nitro group after removing the protection of lithium aluminium hydride.
TP1392 Exendin derivative 1
Exendin derivative 1 is a 39 amino acid peptide.
T13853 Pyridazinediones-derivative-1 Others
Pyridazinediones-derivative-1 has potential in treating neurodegenerative disorders.
T26397 6PGD-IN-S3 6PGD Inhibitor S3,S3,Danthron methyl derivative Dehydrogenase
6PGD-IN-S3 (6PGD Inhibitor S3) is an inhibitor of 6-phosphogluconate dehydrogenase (6PGD).
T11249L Dxd Exatecan derivative for ADC,OQM5SD32BQ,UNII-OQM5SD32BQ Topoisomerase
Dxd (OQM5SD32BQ) is a potent inhibitor of DNA topoisomerase I with an IC50 of 0.31 μM. It is used as a conjugated drug of HER2-targeting ADC.
T10106 3-arylisoquinolinamine derivative Others
3-arylisoquinolinamine derivative is a compound with antitumor activity.
T11654 Indirubin Derivative E804 Others
Indirubin Derivative E804 is an effective inhibitor of IGF1R, which has an IC50 value of 0.65.
T13662 Diarylalkane derivative 1 Others
Diarylalkane derivative 1 is used for the research of pancreatitis.
T19534 Glycerol derivative 1 Others
Glycerol derivative 1 is a Glycerol derivative.
T12333 OT antagonist 1 demethyl derivative Others
OT antagonist 1 demethyl derivative is the demethyl derivative of OT antagonist 1. OT antagonist 1 is a selective Oxytocin antagonist (Ki of 50 nM. )
TP1161 Exendin-4 peptide derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
1 2 3 4 5 ... 150
TargetMol