8
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T25629 | LAQ 824 | LAQ824,LAQ-824 | |
LAQ 824 is an inhibitor of histone deacetylase. | |||
T6561 | Laquinimod | LAQ,ABR-215062 | Apoptosis , Others , NF-κB |
Laquinimod (LAQ) is an effective immunomodulator, which is currently under development in phase III trials for the treatment of multiple sclerosis as an oral therapy. | |||
T2454 | Dacinostat | NVP-LAQ824,LAQ824 | HDAC , Autophagy |
LAQ824 (Dacinostat (NVP-LAQ824)) is a novel HDAC inhibitor with IC50 of 32 nM and is an activator of the p21 promoter. | |||
T2779 | Olaquindox | ||
Olaquindox can be used in relevant research in the life sciences. Its product number is T2779 and CAS number is 23696-28-8. | |||
T37695 | NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ | ||
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions. | |||
T61607 | Laquinimod sodium | ||
Laquinimod (ABR-215062) sodium is a carboxamide derivative administered orally that serves as a powerful immunomodulator, designed to prevent inflammation and neurodegeneration within the central nervous system. This com... | |||
T30612 | Bulaquine | ||
Bulaquine is a derivative of 8-aminoquinoline and has effective activity against the liver stage of plasmodium falciparum and the dormant bodies of Plasmodium vivax and Plasmodium ovale. | |||
TMA0033 | 5'-Demethylaquillochin | NADPH-oxidase | |
5'-Demethylaquillochin and its isomer from the dichloromethane extract of E. cavaleriei have potential as chemopreventive agents through induction of detoxification enzymes. 5'-Demethylaquillochin exhibits the most poten... |