Home Tools
Log in
Cart

Search Result

Search Results for " laq "

8

Compounds

Cat No. Product Name Synonyms Targets
T25629 LAQ 824 LAQ824,LAQ-824
LAQ 824 is an inhibitor of histone deacetylase.
T6561 Laquinimod LAQ,ABR-215062 Apoptosis , Others , NF-κB
Laquinimod (LAQ) is an effective immunomodulator, which is currently under development in phase III trials for the treatment of multiple sclerosis as an oral therapy.
T2454 Dacinostat NVP-LAQ824,LAQ824 HDAC , Autophagy
LAQ824 (Dacinostat (NVP-LAQ824)) is a novel HDAC inhibitor with IC50 of 32 nM and is an activator of the p21 promoter.
T2779 Olaquindox
Olaquindox can be used in relevant research in the life sciences. Its product number is T2779 and CAS number is 23696-28-8.
T37695 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions.
T61607 Laquinimod sodium
Laquinimod (ABR-215062) sodium is a carboxamide derivative administered orally that serves as a powerful immunomodulator, designed to prevent inflammation and neurodegeneration within the central nervous system. This com...
T30612 Bulaquine
Bulaquine is a derivative of 8-aminoquinoline and has effective activity against the liver stage of plasmodium falciparum and the dormant bodies of Plasmodium vivax and Plasmodium ovale.
TMA0033 5'-Demethylaquillochin NADPH-oxidase
5'-Demethylaquillochin and its isomer from the dichloromethane extract of E. cavaleriei have potential as chemopreventive agents through induction of detoxification enzymes. 5'-Demethylaquillochin exhibits the most poten...
TargetMol