Human Papilloma Virus type 6a (HPV 6a) Protein E4 (His & Myc)

Contributes to multiple aspects of the viral life cycle including viral genome amplification, suppression of suprabasal cell differentiation and egress of newly formed virions. Induces host cell cycle arrest at the G2 phase by associating with and preventing the nuclear entry of host CDK1/cyclin B1 complexes. Inhibits cellular DNA replication by preventing loading of host replication licensing proteins MCM2 and MCM7 onto chromatin. Within the cytoplasm, associates with host kinase SRPK1, a splicing factor regulator, and inhibits its activity. Therefore, E4 favors expression of late viral transcripts by inhibiting SRPK1-mediated phosphorylation of host serine-arginine (SR) proteins that have critical roles in mRNA metabolism. Late in the infectious cycle, E4 also acts to diminish the integrity of the keratinocyte by disrupting the keratin cytoskeleton and inducing apoptosis through alteration of mitochondrial function to facilitate egress of the newly formed virions.

Pack Size	Availability	Price/USD
20 μg	20 days	$ 360.00
100 μg	20 days	$ 678.00
1 mg	20 days	$ 2,300.00

Pack Size

Availability

Price/USD

Quantity

20 μg

20 days

$ 360.00

100 μg

20 days

$ 678.00

1 mg

20 days

$ 2,300.00

Description

Species	HPV 6a
Expression System	E. coli
Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Accession Number	Q84295
Amino Acid	MADDSALHKKYPFLNLLHTPPHRPPPLCPQAPRKTQCKRRLENEHEESNSHLATPCVWPTLDPWTVETTTSSLTITTSTKEGTTVTVQLRL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Construction	1-91 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	17.7 kDa (predicted)

Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage	Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shipping	In general, recombinant proteins are provided as lyophilized powder which are shipped at ambient temperature. Bulk packages of recombinant proteins are provided as frozen liquid. They are shipped out with blue ice unless customers require otherwise.
Research Background	Contributes to multiple aspects of the viral life cycle including viral genome amplification, suppression of suprabasal cell differentiation and egress of newly formed virions. Induces host cell cycle arrest at the G2 phase by associating with and preventing the nuclear entry of host CDK1/cyclin B1 complexes. Inhibits cellular DNA replication by preventing loading of host replication licensing proteins MCM2 and MCM7 onto chromatin. Within the cytoplasm, associates with host kinase SRPK1, a splicing factor regulator, and inhibits its activity. Therefore, E4 favors expression of late viral transcripts by inhibiting SRPK1-mediated phosphorylation of host serine-arginine (SR) proteins that have critical roles in mRNA metabolism. Late in the infectious cycle, E4 also acts to diminish the integrity of the keratinocyte by disrupting the keratin cytoskeleton and inducing apoptosis through alteration of mitochondrial function to facilitate egress of the newly formed virions.

Calculator

Reconstitution Calculator

Recombinant Proteins Dilute Calculator

Specific Activity Calculator

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

bottom

Human Papilloma Virus type 6a (HPV 6a) Protein E4 (His & Myc)

Calculator

Tech Support

Keywords