10
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T1428 | Trifluridine | NSC 529182,Trifluorothymidine,5-Trifluorothymidine,NSC 75520,Viroptic,Trifluridina | Nucleoside Antimetabolite/Analog , DNA/RNA Synthesis , HSV |
Trifluridine (NSC-75520) is a fluorinated thymidine analog with potential antineoplastic activity. Trifluridine is incorporated into DNA and inhibits thymidylate synthase, resulting in inhibition of DNA synthesis, inhibi... | |||
TP1419L | HAEGTFT acetate(926018-95-3 free base) | Glucagon Receptor | |
HAEGTFT acetate is the first N-terminal 1-7 residues of GLP-1 peptide. | |||
TP1388 | HAEGTFTSDVSSYLE | Others | |
HAEGTFTSDVSSYLE is a peptide. GLP-I analog contains the sequence. | |||
TP1382L | HAEGTFTSDVS acetate | HAEGTFTSDVS acetate(864915-61-7 free base) | Glucagon Receptor |
HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells. | |||
TP1419 | HAEGTFT | ||
HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide. | |||
T75860 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | |||
TP1382 | HAEGTFTSDVS | ||
HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide. | |||
TP1452 | HAEGTFTSD | ||
HAEGTFTSD is the first N-terminal 1-9 residues of GLP-1 peptide.The GLP-1 (7-36) amide is a product of the preproglucagon gene, which is secreted from intestinal L-cells, in response to the ingestion of food. | |||
TP1452L1 | HAEGTFTSD acetate(926018-45-3 free base) | Glucagon Receptor | |
HAEGTFTSD acetate is the first N-terminal 1-9 residues of GLP-1 peptide.The GLP-1 (7-36) amide is a product of the preproglucagon gene, which is secreted from intestinal L-cells, in response to the ingestion of food. | |||
T3658 | Trifluridine/tipiracil hydrochloride mixture | Trifluridine-tipiracil hydrochloride mixture,TAS102,TAS-102,TAS 102 | Nucleoside Antimetabolite/Analog , DNA/RNA Synthesis |
Trifluridine/tipiracil hydrochloride mixture (TAS-102) is a novel oral combination drug containing trifluridine (TFT) and Tipiracil hydrochloride (TTP) in a molar ratio of 2:1. |