ppp — TargetMol Chemicals

Cat No.	Product Name	Synonyms	Targets
T6943	Picropodophyllin	AXL1717,Picropodophyllin (PPP),Picropodophyllotoxin,PPP	Apoptosis , IGF-1R
	Picropodophyllin (Picropodophyllin (PPP)) (PPP) is a specific IGF-1R inhibitor (IC50: 1 nM). Picropodophyllin specifically inhibits the activity and downregulates the cellular expression of IGF1R without interfering with...		Apoptosis , IGF-1R
T4990	Cefcapene pivoxil hydrochloride hydrate	Cefcapene Pivoxil Hydrochloride	Antibacterial , Antibiotic
	Cefcapene pivoxil hydrochloride hydrate is the pivalate ester prodrug form of cefcapene, a semi-synthetic third-generation cephalosporin with antibacterial activity. After oral administration of cefcapene pivoxil, the es...		Antibacterial , Antibiotic
T74868	Uracil-m7GpppAmpG ammonium
	Uracil-m7GpppAmpG ammonium is a cap analog that can be used for mRNA synthesis.
T74586	M7G(3'-OMe-5')pppA(2'-OMe)
	M7G(3'-OMe-5')pppA(2'-OMe) is a cap analogue for mRNA synthesis in vitro.
T36760	KQMEEEAVRLFIEWLKNGGPSSGAPPPS
	KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon rec...
T74477	M7GpppGmpG ammonium
	M7GpppGmpG ammonium, a trinucleotide 5′ cap analog, exhibits an 86% capping efficiency for the produced RNAs [1].
T74476	M7GpppGmpG
	m7GpppGmpG, a trinucleotide 5′ cap analog, exhibits capping efficiencies of 86% for the RNAs obtained [1].
T74474	M7Gpppm6AmpG ammonium
	M7Gpppm6AmpG ammonium, a trinucleotide mRNA 5’ cap analog, facilitates in vitro RNA synthesis [1].
T74469	3'Ome-m7GpppAmpG
	3'Ome-m7GpppAmpG, a trinucleotide cap analogue with a locked nucleic acid (LNA) molecule, demonstrates notable translational efficiency. It serves as a promising tool in molecular biology, applicable in mRNA vaccines and...
T75860	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
T23043	N-MPPP Hydrochloride		Others
	High affinity κ agonist		Others
T74480	M7GpppCpG
	m7GpppCpG, an oligonucleotide functioning as an M7GpppNpG trinucleotide cap analogue, serves as a chemical tool for the synthesis of RNA with cap 0 or cap 1 structures [1].
T74478	M7GpppUmpG
	m7GpppUmpG, an oligonucleotide and a trinucleotide cap analogue of M 7 GpppNpG, serves as a chemical tool for the production of RNA with either cap 0 or cap 1 structures [1].
T81413	pppApG
	pppApG serves as an initial substrate for the synthesis of vRNA (viral RNA) and cRNA (complementary RNA), with applications in influenza virus research [1].
T75859	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
T74464	M7GpppApG
	M7GpppApG is a trinucleotide mRNA 5' cap analog utilized for in vitro RNA synthesis [1].
T74479	M7GpppUpG
	m7GpppUpG, an oligonucleotide and a trinucleotide cap analogue (M 7 GpppNpG), serves as a chemical tool for the production of RNA with either cap 0 or cap 1 structures [1].
T74470	3'Ome-m7GpppAmpG ammonium
	3'Ome-m7GpppAmpG ammonium, a trinucleotide Cap analogue with a locked nucleic acid (LNA) component, demonstrates substantial translational efficiency. It emerges as a promising tool in molecular biology, applicable in mR...
T74475	M7GpppGpG
	M7GpppGpG, a trinucleotide cap analogue and oligonucleotide, protects against premature degradation by 5′-exonucleases and facilitates pre-mRNA splicing, mRNA transport, and protein biosynthesis initiation by recruiting ...
T74472	M7GpppAmpG ammonium
	m7GpppAmpG ammonium is a trinucleotide 5′ cap analog that exhibits capping efficiencies of 90% for the RNAs obtained [1].