3
7
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T76250 | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW | ||
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of α2δ-1 and is recognized as the α2δ-1Tat peptide. It disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, offering a p... | |||
T76250L | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA | ||
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, demonstrati... | |||
T71476 | Afegostat TFA | ||
Afegostat, aslo known as Isofagomine, and AT2101, was an experimental drug for the treatment of certain forms of Gaucher's disease. Isofagomine (IFG) is an acid β-glucosidase (GCase) active site inhibitor that acts as a ... |
Cat No. | Product Name | Species | Expression System |
---|---|---|---|
TMPY-03356 | IFN gamma Protein, Mouse, Recombinant | Mouse | HEK293 |
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ... | |||
TMPY-06983 | IFN gamma Protein, Human, Recombinant (E. coli) | Human | E. coli |
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ... | |||
TMPY-01714 | IFN gamma Protein, Human, Recombinant | Human | CHO |
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ... | |||
TMPK-00047 | IFN gamma Protein, Human, Recombinant (His & Avi) | Human | HEK293 |
Interferon-gamma (IFN gamma) is a cytokine that plays physiologically important roles in promoting innate and adaptive immune responses. The absence of IFN gamma production or cellular responsiveness in humans and experi... | |||
TMPY-02323 | IFN gamma Protein, Mouse, Recombinant (His) | Mouse | HEK293 |
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ... | |||
TMPY-02322 | IFN gamma Protein, Mouse, Recombinant (hFc) | Mouse | HEK293 |
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ... | |||
TMPK-00048 | IFN gamma Protein, Human, Recombinant (His & Avi), Biotinylated | Human | HEK293 |
Interferon-gamma (IFN gamma) is a cytokine that plays physiologically important roles in promoting innate and adaptive immune responses. The absence of IFN gamma production or cellular responsiveness in humans and experi... |