Home Tools
Log in
Cart

Search Result

Search Results for " ifg "

3

Compounds

7

Recombinant Proteins

Cat No. Product Name Synonyms Targets
T76250 VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of α2δ-1 and is recognized as the α2δ-1Tat peptide. It disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, offering a p...
T76250L VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA), a 30-amino-acid peptide, mimics the C-terminal domain of α2δ-1, known as α2δ-1Tat peptide. This compound disrupts the α2δ-1 - NMDAR interaction both in vitro and in vivo, demonstrati...
T71476 Afegostat TFA
Afegostat, aslo known as Isofagomine, and AT2101, was an experimental drug for the treatment of certain forms of Gaucher's disease. Isofagomine (IFG) is an acid β-glucosidase (GCase) active site inhibitor that acts as a ...

Recombinant Proteins

Cat No. Product Name Species Expression System
TMPY-03356 IFN gamma Protein, Mouse, Recombinant Mouse HEK293
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ...
TMPY-06983 IFN gamma Protein, Human, Recombinant (E. coli) Human E. coli
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ...
TMPY-01714 IFN gamma Protein, Human, Recombinant Human CHO
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ...
TMPK-00047 IFN gamma Protein, Human, Recombinant (His & Avi) Human HEK293
Interferon-gamma (IFN gamma) is a cytokine that plays physiologically important roles in promoting innate and adaptive immune responses. The absence of IFN gamma production or cellular responsiveness in humans and experi...
TMPY-02323 IFN gamma Protein, Mouse, Recombinant (His) Mouse HEK293
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ...
TMPY-02322 IFN gamma Protein, Mouse, Recombinant (hFc) Mouse HEK293
IFN gamma, also known as IFNG, is a secreted protein that belongs to the type II interferon family. IFN gamma is produced predominantly by natural killer and natural killer T cells as part of the innate immune response, ...
TMPK-00048 IFN gamma Protein, Human, Recombinant (His & Avi), Biotinylated Human HEK293
Interferon-gamma (IFN gamma) is a cytokine that plays physiologically important roles in promoting innate and adaptive immune responses. The absence of IFN gamma production or cellular responsiveness in humans and experi...
TargetMol