Home Tools
Log in
Cart

Search Result

Search Results for " exendin "

20

Compounds

Cat No. Product Name Synonyms Targets
T8748 Exendin-4 acetate Glucagon Receptor
Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM).
T3967 Exendin-4 Exenatide,Exenatide Acetate Glucagon Receptor
Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours.
TP1389 Exendin-3/4 (64-86) Others
Exendin-3/4 (64-86) is a polypeptide.
TP2100 Avexitide Exendin-3 (9-39) amide,Exendin (9-39) Glucagon Receptor
Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.
T8355 Exenatide Exendin-4,Extendin-4 Glucagon Receptor
Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist.
TP1154 Exendin-4 peptide derivative acetate GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS,Exendin-4 peptide derivative
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.
T39384 Exendin (5-39)
Exendin (5-39) is a powerful antagonist of the glucagon-like peptide 1 (GLP-1) receptor with the ability to ameliorate memory impairment in rats treated with β-amyloid protein.
TP1768 Exendin-3
Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn . Exendin-3 is a pancreatic secretagogue, which is a member of the glucagon family. It is found in the ve...
TP1392 Exendin derivative 1
Exendin derivative 1 is a 39 amino acid peptide.
TP1394 {Val1}-Exendin-3/4
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.
TP1461 SDV-Exendin-3/4
SDV-Exendin-3/4 is a 32-amino acid peptide.
TP1161 Exendin-4 peptide derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
TP1366 Exendin-3/4 (59-86)
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.
TP2100L Avexitide acetate Exendin 9-39 acetate,Avexitide acetate(133514-43-9 Free base) Glucagon Receptor
Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia.
T76290 Exendin-4 (3-39)
Exendin-4 (3-39) is a truncated peptide variant of Exendin-4, missing the initial two amino acids, and serves as a potent agonist for the Glucagon-like peptide-1 receptor (GLP-1r). This compound, along with Exendin-4, is...
T76291 Des His1, Glu8 Exendin-4
Des His1, Glu8 Exendin-4 is a potent antagonist of the glucagon-like peptide-1 receptor (GLP-1-R), enhancing glucose homeostasis through the dual regulation of insulin secretion and glucose production. This compound is e...
T75859 FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
TP2368 Albenatide CJC1134,CJC 1134,CJC-1134
Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.
T75860 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
T36760 KQMEEEAVRLFIEWLKNGGPSSGAPPPS
KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon rec...
TargetMol