20
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T8748 | Exendin-4 acetate | Glucagon Receptor | |
Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM). | |||
T3967 | Exendin-4 | Exenatide,Exenatide Acetate | Glucagon Receptor |
Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours. | |||
TP1389 | Exendin-3/4 (64-86) | Others | |
Exendin-3/4 (64-86) is a polypeptide. | |||
TP2100 | Avexitide | Exendin-3 (9-39) amide,Exendin (9-39) | Glucagon Receptor |
Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor. | |||
T8355 | Exenatide | Exendin-4,Extendin-4 | Glucagon Receptor |
Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist. | |||
TP1154 | Exendin-4 peptide derivative acetate | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS,Exendin-4 peptide derivative | |
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative. | |||
T39384 | Exendin (5-39) | ||
Exendin (5-39) is a powerful antagonist of the glucagon-like peptide 1 (GLP-1) receptor with the ability to ameliorate memory impairment in rats treated with β-amyloid protein. | |||
TP1768 | Exendin-3 | ||
Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn . Exendin-3 is a pancreatic secretagogue, which is a member of the glucagon family. It is found in the ve... | |||
TP1392 | Exendin derivative 1 | ||
Exendin derivative 1 is a 39 amino acid peptide. | |||
TP1394 | {Val1}-Exendin-3/4 | ||
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide. | |||
TP1461 | SDV-Exendin-3/4 | ||
SDV-Exendin-3/4 is a 32-amino acid peptide. | |||
TP1161 | Exendin-4 peptide derivative | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | |
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. | |||
TP1366 | Exendin-3/4 (59-86) | ||
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative. | |||
TP2100L | Avexitide acetate | Exendin 9-39 acetate,Avexitide acetate(133514-43-9 Free base) | Glucagon Receptor |
Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia. | |||
T76290 | Exendin-4 (3-39) | ||
Exendin-4 (3-39) is a truncated peptide variant of Exendin-4, missing the initial two amino acids, and serves as a potent agonist for the Glucagon-like peptide-1 receptor (GLP-1r). This compound, along with Exendin-4, is... | |||
T76291 | Des His1, Glu8 Exendin-4 | ||
Des His1, Glu8 Exendin-4 is a potent antagonist of the glucagon-like peptide-1 receptor (GLP-1-R), enhancing glucose homeostasis through the dual regulation of insulin secretion and glucose production. This compound is e... | |||
T75859 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | |||
TP2368 | Albenatide | CJC1134,CJC 1134,CJC-1134 | |
Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin. | |||
T75860 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | |||
T36760 | KQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon rec... |