Shopping Cart
Remove All
Your shopping cart is currently empty
Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc)
Copy Product Info
Catalog No. TMPH-00811
Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome. Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 25.4 kDa and the accession number is P06934.
Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc)
Copy Product InfoCatalog No. TMPH-00811
Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome. Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 25.4 kDa and the accession number is P06934.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 μg | $125 | 20 days | 20 days | |
| 10 μg | $198 | 20 days | 20 days | |
| 20 μg | $341 | 20 days | 20 days | |
| 50 μg | $497 | 20 days | 20 days | |
| 100 μg | $696 | 20 days | 20 days | |
| 200 μg | $1,080 | 20 days | 20 days | |
| 500 μg | $1,950 | 20 days | 20 days |
Add to Cart
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse [1-2 days] Global Warehouse [5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome. Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 25.4 kDa and the accession number is P06934. |
| Species | HDV |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis, C-Myc |
| Accession Number | P06934 |
| Synonyms | Small delta antigen,S-HDAg,p24 |
| Amino Acid | MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP |
| Construction | 1-195 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 25.4 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.