Home Tools
Log in
Cart

Bovine coronavirus (strain LY-138) Non-structural Protein 4a (His & SUMO)

Catalog No. TMPH-00247
Synonyms: ns4.9, 4.9 kDa accessory protein, Non-structural protein of 4.9 kDa

Bovine coronavirus (strain LY-138) Non-structural Protein 4a (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 18.0 kDa and the accession number is Q9QAS1.

All products from TargetMol are for Research Use Only. Not for Human or Veterinary or Therapeutic Use.
Bovine coronavirus (strain LY-138) Non-structural Protein 4a (His & SUMO)
Pack Size Availability Price/USD Quantity
20 μg 20 days $ 360.00
100 μg 20 days $ 678.00
1 mg 20 days $ 2,300.00
Bulk Inquiry
Get quote
Contact us for more batch information
Technical Params
Product Properties
Description Bovine coronavirus (strain LY-138) Non-structural Protein 4a (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 18.0 kDa and the accession number is Q9QAS1.
Species BCoV
Expression System E. coli
Tag N-6xHis-SUMO
Accession Number Q9QAS1
Synonyms ns4.9, 4.9 kDa accessory protein, Non-structural protein of 4.9 kDa
Amino Acid MTTKFVFDLLAPDDILHPFNHVKLIIIRPIEVEHIIIATTMPAV
Construction 1-44 aa
Protein Purity > 85% as determined by SDS-PAGE.
Molecular Weight 18.0 kDa (predicted)
Formulation If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at-80℃. For reconstituted proteinsolutions, the solution can be stored at -20°c to -80'c for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Shipping

In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Calculator

Reconstitution Calculator
Recombinant Proteins Dilute Calculator
Specific Activity Calculator
=
÷
X
=
X
(Unit/mg)
= 106 ÷
ng/mL

bottom

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

Bovine coronavirus (strain LY-138) Non-structural Protein 4a (His & SUMO) ns4.9 4.9 kDa accessory protein Non-structural protein of 4.9 kDa recombinant recombinant-proteins proteins protein

 

TargetMol