4
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T13907 | Sulfo-ara-F-NMN | CZ-48 | Others |
Sulfo-ara-F-NMN is an analogue of nicotinamide mononucleotide (NMN) with cellular permeability. Sulfo-ara-F-NMN was selective to activate SARM1 and inhibited CD38 with an IC50 of about 10 μM. Activation by Sulfo-ara-F-NM... | |||
T12854 | SBI-797812 | NAMPT | |
SBI-797812 is structurally similar to active-site directed inhibitor of NAMPT(NAMPT with EC50 of 0.37 μM). | |||
T4721 | β-Nicotinamide mononucleotide | β-NM | Others , Endogenous Metabolite |
β-Nicotinamide mononucleotide (β-NM) is an important intermediate metabolite in the nicotinate and nicotinamide metabolism pathway. Mammals predominantly use nicotinamide rather than nicotinic acid as a precursor for NAD... | |||
T37695 | NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ | ||
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions. |