Home Tools
Log in
Cart

Search Result

Search Results for " nmn "

4

Compounds

Cat No. Product Name Synonyms Targets
T13907 Sulfo-ara-F-NMN CZ-48 Others
Sulfo-ara-F-NMN is an analogue of nicotinamide mononucleotide (NMN) with cellular permeability. Sulfo-ara-F-NMN was selective to activate SARM1 and inhibited CD38 with an IC50 of about 10 μM. Activation by Sulfo-ara-F-NM...
T12854 SBI-797812 NAMPT
SBI-797812 is structurally similar to active-site directed inhibitor of NAMPT(NAMPT with EC50 of 0.37 μM).
T4721 β-Nicotinamide mononucleotide β-NM Others , Endogenous Metabolite
β-Nicotinamide mononucleotide (β-NM) is an important intermediate metabolite in the nicotinate and nicotinamide metabolism pathway. Mammals predominantly use nicotinamide rather than nicotinic acid as a precursor for NAD...
T37695 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions.
TargetMol