5
6
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
TP1267L | CEF27, Epstein-Barr Virus BRLF-1 lytic 148-156 acetate | CEF27, Epstein-Barr Virus BRLF-1 lytic 148-156 acetate(254110-79-7 free base) | Others |
CEF27, Epstein-Barr Virus BRLF-1 lytic 148-156 acetate corresponding to amino acids 148-156 of the BRLF1. BRLF1 is a transcriptional activator that binds directly to a GC-rich motif present in some Epstein-Barr virus (EB... | |||
T36760 | KQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon rec... | |||
T75860 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | |||
T75859 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | |||
TP1267 | CEF27, Epstein-Barr Virus BRLF-1 lytic (148-156) | CEF27,Epstein-Barr Virus BRLF-1 lytic 148-156 | |
HLA-A*0301-restricted epitope from Epstein-Barr Virus , EBV BRLF-1 (148-156). |
Cat No. | Product Name | Species | Expression System |
---|---|---|---|
TMPJ-00577 | INSL3 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
Insulin-like 3 is a protein that in humans is encoded by the INSL3 gene. It is a secreted protein that belongs to the insulin family. It is expressed in prenatal and postnatal Leydig cells and found as well in the corpus... | |||
TMPY-05242 | CRLF2/TSLPR Protein, Human, Recombinant (His) | Human | HEK293 Cells |
CRLF2/TSLPR Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 25.6 kDa and the accession number is D0E2W4. | |||
TMPH-01187 | CRLF1 Protein, Human, Recombinant (E. coli, His & Myc) | Human | E. coli |
CRLF1 Protein, Human, Recombinant (E. coli, His & Myc) is expressed in E. coli. | |||
TMPY-05769 | CRLF2/TSLPR Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
CRLF2/TSLPR Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 50.91 kDa and the accession number is D0E2W4. | |||
TMPH-01188 | CRLF1 Protein, Human, Recombinant (His & Myc) | Human | Baculovirus Insect Cells |
CRLF1 Protein, Human, Recombinant (His & Myc) is expressed in Baculovirus. | |||
TMPH-00545 | Epstein-Barr virus (strain GD1) BRLF1 Protein (His & Myc) | EBV | E. coli |
Immediate-early transcription factor that controls the initiation of viral lytic gene expression and lytic reactivation from latency. Triggers lytic replication, and initiates a cellular senescence program in epithelial ... |