15
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T3967 | Exendin-4 | Exenatide,Exenatide Acetate | Glucagon Receptor |
Exendin-4 (Exenatide) is a glucagon-like peptide-1 receptor (GLP-1) agonist (IC50: 3.22 nM). Exenatide is a 39 amino acid peptide. Compared to GLP-1, exenatide has a longer half-life of 2.4 hours. | |||
TP1389 | Exendin-3/4 (64-86) | Others | |
Exendin-3/4 (64-86) is a polypeptide. | |||
T8748 | Exendin-4 acetate | Glucagon Receptor | |
Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM). | |||
T8355 | Exenatide | Exendin-4,Extendin-4 | Glucagon Receptor |
Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist. | |||
TP1394 | {Val1}-Exendin-3/4 | ||
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide. | |||
TP1461 | SDV-Exendin-3/4 | ||
SDV-Exendin-3/4 is a 32-amino acid peptide. | |||
TP1154 | Exendin-4 peptide derivative acetate | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS,Exendin-4 peptide derivative | |
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative. | |||
TP1161 | Exendin-4 peptide derivative | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | |
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. | |||
TP1366 | Exendin-3/4 (59-86) | ||
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative. | |||
T76290 | Exendin-4 (3-39) | ||
Exendin-4 (3-39) is a truncated peptide variant of Exendin-4, missing the initial two amino acids, and serves as a potent agonist for the Glucagon-like peptide-1 receptor (GLP-1r). This compound, along with Exendin-4, is... | |||
T76291 | Des His1, Glu8 Exendin-4 | ||
Des His1, Glu8 Exendin-4 is a potent antagonist of the glucagon-like peptide-1 receptor (GLP-1-R), enhancing glucose homeostasis through the dual regulation of insulin secretion and glucose production. This compound is e... | |||
T75859 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | |||
TP2368 | Albenatide | CJC1134,CJC 1134,CJC-1134 | |
Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin. | |||
T75860 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | |||
T36760 | KQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon rec... |