Home Tools
Log in
Cart

Search Result

Search Results for " myp "
All TargetMol products are for research or drug registration purposes only and cannot be used for human consumption.
We do not provide products or services to individuals.
Please comply with the intended use and do not use TargetMol products for any other purpose in violation of laws and regulations.

1

Compounds

3

Recombinant Proteins

Cat No. Product Name Synonyms Targets
T37695 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ, an ACE2-related peptide, serves as a valuable research tool for comprehending ACE2 functions.

Recombinant Proteins

Cat No. Product Name Species Expression System
TMPJ-00696 NOL3 Protein, Human, Recombinant Human E. coli
Nucleolar protein 3 is encoded by NOL3 gene. Multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in...
TMPJ-00697 NOL3 Protein, Human, Recombinant (GST) Human E. coli
Nucleolar Protein 3 is encoded by NOL3 gene; multiple transcript variants encoding different isoforms have been found for this gene. So far, Nucleolar protein 3 has show to have two Isoforms. Isoform 1 may be involved in...
TMPY-01233 LRPAP1 Protein, Human, Recombinant (His) Human HEK293 Cells
LRPAP1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 39.2 kDa and the accession number is P30533.
TargetMol