3
3
Cat No. | Product Name | Synonyms | Targets |
---|---|---|---|
T36760 | KQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon rec... | |||
T75860 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. | |||
T75859 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | ||
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. |
Cat No. | Product Name | Species | Expression System |
---|---|---|---|
TMPY-01606 | Kininogen 1 Protein, Mouse, Recombinant (His) | Mouse | HEK293 Cells |
Kininogen 1 Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 52.5 kDa and the accession number is D3YTY9. | |||
TMPY-01598 | Kininogen 1 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
Kininogen 1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 71.3 kDa and the accession number is P01042-1. | |||
TMPJ-00734 | KNG1 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
Kininogen-1 is a secreted protein which contains three cystatin domains. There are two alternatively spliced forms, designated as the high molecular weight (HMW) and low MW (LMW) forms. Kininogen-1 plays a critical role ... |