Shopping Cart
- Remove All
- Your shopping cart is currently empty
Neuropeptide with many biological actions
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | Inquiry | Backorder | |
100 mg | Inquiry | Backorder | |
500 mg | Inquiry | Backorder |
Description | Neuropeptide with many biological actions |
Alias | VIP (guinea pig) |
Molecular Weight | 3344.86 |
Formula | C147H239N43O42S2 |
Cas No. | 96886-24-7 |
Relative Density. | 1.31g/cm3 |
Sequence | His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH2 |
Sequence Short | HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Solubility Information | H2O: 1 mg/mL (0.3 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.