Shopping Cart
Remove All
Your shopping cart is currently empty
Neuropeptide with many biological actions

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | Inquiry | Backorder | Backorder | |
| 100 mg | Inquiry | Backorder | Backorder | |
| 500 mg | Inquiry | Backorder | Backorder |
| Description | Neuropeptide with many biological actions |
| Synonyms | VIP (guinea pig) |
| Molecular Weight | 3344.86 |
| Formula | C147H239N43O42S2 |
| Cas No. | 96886-24-7 |
| Relative Density. | 1.31g/cm3 |
| Sequence | His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH2 |
| Sequence Short | HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 1 mg/mL (0.3 mM), Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.