Your shopping cart is currently empty

PACAP 1-38 acetate is a pituitary adenylate cyclase activating polypeptide (PACAP) analogue. PACAP 1-38 acetate binds to PACAP type I receptor(IC50 = 4 nM) and PACAP type II VIP2 receptor(IC50 = 1 nM) but not to PACAP type II, VIP1 receptor.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $163 | Inquiry | Inquiry | |
| 5 mg | $477 | Inquiry | Inquiry | |
| 10 mg | $698 | Inquiry | Inquiry | |
| 25 mg | $1,090 | Inquiry | Inquiry | |
| 50 mg | $1,470 | Inquiry | Inquiry | |
| 100 mg | $1,990 | Inquiry | Inquiry |
| Description | PACAP 1-38 acetate is a pituitary adenylate cyclase activating polypeptide (PACAP) analogue. PACAP 1-38 acetate binds to PACAP type I receptor(IC50 = 4 nM) and PACAP type II VIP2 receptor(IC50 = 1 nM) but not to PACAP type II, VIP1 receptor. |
| Targets&IC50 | PACAP type I:4 nM, PACAP type II VIP2:1 nM |
| In vitro | The ability of neuropeptides to modulate enteric smooth muscle proliferation was examined in primary explant cultures of rabbit gastric antrum and colon smooth muscle. Cell proliferation was determined by [3H]thymidine incorporation measurements and cell counting. PACAP 1-38 acetate concentration dependently (10(-10)M to 10(-6)M) inhibited the serum-induced [3H]thymidine incorporation [in colon, 55.6 +/- 9.3% of control with 10(-7)M PACAP 1-38 acetate] and inhibited increase in cell numbers in cultures derived from the colon but not in those from the antrum. Effects of PACAP 1-38 acetate were mimicked by forskolin (10(-7) to 10(-6) M) but not by 8-bromo-cGMP. Substance P, motilin, calcitonin gene-related peptide, and somatostatin had no effect[3]. |
| In vivo | The effect on total pulmonary resistance (R1) was examined for inhaled PACAP 1-38 acetate in anesthetized, ventilated guinea pigs. Two minutes after inhalation, PACAP 1-38 acetate (36 +/- 6%) inhibited the increase in R1 (% inhibition of histamine-induced R1 prior to inhalation) caused by histamine i.v., whereas the vehicle (-1 +/- 10%) did not. The inhaled peptides caused no sustained effects on heart rate or blood pressure. Infusion of PACAP 1-38 acetate i.v. dose-dependently inhibited the increase in R1 caused by inhaled histamine and by carbachol i.v.[4]. |
| Molecular Weight | 4595.29 |
| Formula | C205H334N62O56S |
| Smiles | CC(O)=O.CCC(C)C(NC(=O)CNC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(N)CC1=CN=CN1)C(=O)NC(CC1=CC=CC=C1)C(=O)NC(C(C)O)C(=O)NC(CC(O)=O)C(=O)NC(CO)C(=O)NC(CC1=CC=C(O)C=C1)C(=O)NC(CO)C(=O)NC(CCCNC(N)=N)C(=O)NC(CC1=CC=C(O)C=C1)C(=O)NC(CCCNC(N)=N)C(=O)NC(CCCCN)C(=O)NC(CCC(N)=O)C(=O)NC(CCSC)C(=O)NC(C)C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CC1=CC=C(O)C=C1)C(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(C)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CCCNC(N)=N)C(=O)NC(CC1=CC=C(O)C=C1)C(=O)NC(CCCCN)C(=O)NC(CCC(N)=O)C(=O)NC(CCCNC(N)=N)C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC(CC(N)=O)C(=O)NC(CCCCN)C(O)=O |
| Relative Density. | no data available |
| Sequence | His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys |
| Sequence Short | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
| Storage | Keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||||||||||||
| Solubility Information | H2O: 100.00 mg/mL (21.76 mM), Sonication is recommended. | |||||||||||||||||||||||||
Solution Preparation Table | ||||||||||||||||||||||||||
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | ||||||||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.