Shopping Cart
- Remove All
- Your shopping cart is currently empty
PACAP 1-38 acetate is a pituitary adenylate cyclase activating polypeptide (PACAP) analogue. PACAP 1-38 acetate binds to PACAP type I receptor(IC50 = 4 nM) and PACAP type II VIP2 receptor(IC50 = 1 nM) but not to PACAP type II, VIP1 receptor.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $163 | In Stock | |
5 mg | $477 | In Stock | |
10 mg | $698 | In Stock | |
25 mg | $1,090 | In Stock | |
50 mg | $1,470 | In Stock | |
100 mg | $1,990 | In Stock |
Description | PACAP 1-38 acetate is a pituitary adenylate cyclase activating polypeptide (PACAP) analogue. PACAP 1-38 acetate binds to PACAP type I receptor(IC50 = 4 nM) and PACAP type II VIP2 receptor(IC50 = 1 nM) but not to PACAP type II, VIP1 receptor. |
Targets&IC50 | PACAP type II VIP2:1 nM, PACAP type I:4 nM |
In vitro | The ability of neuropeptides to modulate enteric smooth muscle proliferation was examined in primary explant cultures of rabbit gastric antrum and colon smooth muscle. Cell proliferation was determined by [3H]thymidine incorporation measurements and cell counting. PACAP 1-38 acetate concentration dependently (10(-10)M to 10(-6)M) inhibited the serum-induced [3H]thymidine incorporation [in colon, 55.6 +/- 9.3% of control with 10(-7)M PACAP 1-38 acetate] and inhibited increase in cell numbers in cultures derived from the colon but not in those from the antrum. Effects of PACAP 1-38 acetate were mimicked by forskolin (10(-7) to 10(-6) M) but not by 8-bromo-cGMP. Substance P, motilin, calcitonin gene-related peptide, and somatostatin had no effect[3]. |
In vivo | The effect on total pulmonary resistance (R1) was examined for inhaled PACAP 1-38 acetate in anesthetized, ventilated guinea pigs. Two minutes after inhalation, PACAP 1-38 acetate (36 +/- 6%) inhibited the increase in R1 (% inhibition of histamine-induced R1 prior to inhalation) caused by histamine i.v., whereas the vehicle (-1 +/- 10%) did not. The inhaled peptides caused no sustained effects on heart rate or blood pressure. Infusion of PACAP 1-38 acetate i.v. dose-dependently inhibited the increase in R1 caused by inhaled histamine and by carbachol i.v.[4]. |
Relative Density. | no data available |
Color | White |
Appearance | Solid |
Sequence | His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys |
Sequence Short | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 100 mg/mL, Sonication is recommended. ![]() |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.