Your shopping cart is currently empty

PACAP (6-38), human, ovine, rat acetate is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $89 | - | In Stock | |
| 5 mg | $262 | - | In Stock | |
| 10 mg | $351 | - | In Stock | |
| 25 mg | $562 | - | In Stock | |
| 50 mg | $762 | - | In Stock | |
| 100 mg | $1,030 | - | In Stock | |
| 200 mg | $1,390 | - | In Stock |
| Description | PACAP (6-38), human, ovine, rat acetate is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. |
| In vitro | An increase of dopamine (DA) content by HPLC analysis and/or cell proliferation identified by MTT assay by Dexamethasone (DEX) is also observed which can be inhibited by PACAP (6-38) at concentration sufficient to block PACAP type 1 (PAC1) receptor. Pretreatment with PACAP (6-38) at 0.1 or 1 μM for 2 h significantly blocks this increase of DA content by 1 μM DEX. The MTT assay shows that DEX increases cell proliferation. Moreover, this action is also inhibited by the pre-incubation of PACAP (6-38). PACAP (6-38) at 1μM shows no effect on DA content and cell proliferation for 24 h. However, PACAP (6-38) at 0.3 μM has been mentioned to reduce the spontaneous tyrosine hydroxylase (TH) accumulation in differentiated retinal cultured cells for 5 days[2]. |
| In vivo | Intravesical administration of PACAP (6-38) (300 nM) significantly (p≤0.01) increases intercontraction interval (2.0-fold) and void volume (2.5-fold) in NGF-OE mice. Intravesical instillation of PACAP (6-38) also decreases baseline bladder pressure in NGF-OE mice. Intravesical administration of PACAP (6-38) (300 nM) significantly (p≤0.01) reduces pelvic sensitivity in NGF-OE mice but is without effect in WT mice[3]. |
| Molecular Weight | 4085.84 |
| Formula | C184H303N55O48S |
| Smiles | [H]N[C@@H](CC1=CC=CC=C1)C(N[C@]([H])(C(N[C@@H](CC(O)=O)C(N[C@H](C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@H](C(N[C@H](C(N[C@@H](CC3=CC=C(C=C3)O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCSC)C(N[C@@H](C)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC4=CC=C(C=C4)O)C(N[C@H](C(N[C@@H](C)C(N[C@@H](C)C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@@H](CC5=CC=C(C=C5)O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(O)=O)CCCCN)=O)CC(N)=O)=O)CCCCN)=O)C(C)C)=O)CCCNC(N)=N)=O)CCC(N)=O)=O)CCCCN)=O)=O)CCCNC(N)=N)=O)CCCCN)=O)=O)CC(C)C)=O)C(C)C)=O)=O)=O)CC(C)C)=O)=O)CCCCN)=O)CCCCN)=O)C(C)C)=O)=O)=O)CCC(N)=O)=O)CCCCN)=O)CCCNC(N)=N)=O)=O)CCCNC(N)=N)=O)CO)=O)=O)CO)=O)=O)[C@H](O)C)=O.CC(O)=O |
| Relative Density. | no data available |
| Sequence | Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 |
| Sequence Short | FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
| Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | H2O: 50 mg/mL (12.24 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.