Your shopping cart is currently empty

PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrin secretion and promoting the release of vasoactive intestinal polypeptide, gastrin-releasing peptide, and substance P. Additionally, it amplifies N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1 [1] [2].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrin secretion and promoting the release of vasoactive intestinal polypeptide, gastrin-releasing peptide, and substance P. Additionally, it amplifies N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1 [1] [2]. |
| In vitro | PACAP (1-38) free acid TFA at 1 nM concentration enhances the release of Substance P, gastrin-releasing peptide, and vasoactive intestinal peptide [1]. |
| Sequence | His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys |
| Sequence Short | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKR YKQRVKNK |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.