Shopping Cart
Remove All
Your shopping cart is currently empty
PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrin secretion and promoting the release of vasoactive intestinal polypeptide, gastrin-releasing peptide, and substance P. Additionally, it amplifies N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1 [1] [2].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrin secretion and promoting the release of vasoactive intestinal polypeptide, gastrin-releasing peptide, and substance P. Additionally, it amplifies N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1 [1] [2]. |
| In vitro | PACAP (1-38) free acid TFA at 1 nM concentration enhances the release of Substance P, gastrin-releasing peptide, and vasoactive intestinal peptide [1]. |
| Sequence | His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys |
| Sequence Short | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKR YKQRVKNK |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.