Shopping Cart
Remove All
Your shopping cart is currently empty
Synonyms: PACAP (1-38) free acid

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $98 | - | In Stock | |
| 5 mg | $247 | - | In Stock | |
| 10 mg | $367 | - | In Stock | |
| 25 mg | $595 | - | In Stock | |
| 50 mg | $862 | - | In Stock | |
| 100 mg | $1,160 | - | In Stock |
| Description | PACAP (1-38) free acid is a deamidated PACAP (1-38) derived from humans, sheep, and rats. PACAP (1-38) free acid can activate the human PAC1 receptor and promote cyclic adenosine monophosphate synthesis in NS‑1 neuroendocrine cells and non-neuroendocrine HEK293 cells. |
| Targets & IC50 | NS‑1 cells:10.6 nM (EC50) |
| In vitro | PACAP (1-38) free acid promotes neuroendocrine differentiation in NS‑1 cells after 48-hour treatment, with an EC50 of 10.6 nM. Following 24-hour intervention within the concentration range of 0.1–300 nM, PACAP (1‑38) free acid induces growth arrest in NS‑1 cells [1]. |
| Synonyms | PACAP (1-38) free acid |
| Molecular Weight | 4535.24 |
| Formula | C203H330N62O54S |
| Cas No. | 129405-61-4 |
| Smiles | [H]N[C@@H](CC1=CN=CN1)C(N[C@H](C(N[C@@H](CC(O)=O)C(NCC(N[C@]([H])(C(N[C@@H](CC2=CC=CC=C2)C(N[C@]([H])(C(N[C@@H](CC(O)=O)C(N[C@H](C(N[C@@H](CC3=CC=C(C=C3)O)C(N[C@H](C(N[C@H](C(N[C@@H](CC4=CC=C(C=C4)O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCSC)C(N[C@@H](C)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC5=CC=C(C=C5)O)C(N[C@H](C(N[C@@H](C)C(N[C@@H](C)C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@@H](CC6=CC=C(C=C6)O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(O)=O)CCCCN)=O)CC(N)=O)=O)CCCCN)=O)C(C)C)=O)CCCNC(N)=N)=O)CCC(N)=O)=O)CCCCN)=O)=O)CCCNC(N)=N)=O)CCCCN)=O)=O)CC(C)C)=O)C(C)C)=O)=O)=O)CC(C)C)=O)=O)CCCCN)=O)CCCCN)=O)C(C)C)=O)=O)=O)CCC(N)=O)=O)CCCCN)=O)CCCNC(N)=N)=O)=O)CCCNC(N)=N)=O)CO)=O)=O)CO)=O)=O)[C@H](O)C)=O)=O)[C@@H](C)CC)=O)=O)=O)CO)=O |
| Sequence | His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys |
| Sequence Short | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
| Storage | Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | DMSO: 80.00 mg/mL (17.64 mM), Sonication is recommended. H2O: 80.00 mg/mL (17.64 mM) | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
DMSO/H2O
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density. | |||||||||||||||||||||
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.