Shopping Cart
Remove All
Your shopping cart is currently empty
PACAP (1-38) free acid, an endogenous neuropeptide, potently modulates gastrointestinal and neuroendocrine functions. It enhances antral motility, increases somatostatin secretion, and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide, and substance P, while concurrently inhibiting gastrin secretion. Additionally, it augments N-methyl-D-aspartate receptor function and upregulates brain-derived neurotrophic factor expression via RACK1 [1] [2].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Backorder | Backorder | |
| 50 mg | Inquiry | Backorder | Backorder |
| Description | PACAP (1-38) free acid, an endogenous neuropeptide, potently modulates gastrointestinal and neuroendocrine functions. It enhances antral motility, increases somatostatin secretion, and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide, and substance P, while concurrently inhibiting gastrin secretion. Additionally, it augments N-methyl-D-aspartate receptor function and upregulates brain-derived neurotrophic factor expression via RACK1 [1] [2]. |
| In vitro | PACAP (1-38) free acid at 1 nM concentration enhances the release of substance P, gastrin-releasing peptide, and vasoactive intestinal peptide [1]. |
| Cas No. | 129405-61-4 |
| Sequence | His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys |
| Sequence Short | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.