Shopping Cart
Remove All
Your shopping cart is currently empty
Vasoactive Intestinal Peptide (VIP) Guinea pig TFA, a trophic and mitogenic factor, promotes growth in cultured whole embryos and acts as a gastrointestinal hormone, while also indicating potential neurotransmitter functions [1] [2].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Vasoactive Intestinal Peptide (VIP) Guinea pig TFA, a trophic and mitogenic factor, promotes growth in cultured whole embryos and acts as a gastrointestinal hormone, while also indicating potential neurotransmitter functions [1] [2]. |
| In vitro | Vasoactive intestinal peptide at a concentration of 10(-7)M significantly accelerated the cell cycle of neuroepithelial cells by reducing the duration of the S phase and the G1 phase by 50% (from 4.8 to 2.4 hours) and 58% (from 1.9 to 0.8 hours), respectively, when compared with control samples [1]. |
| Synonyms | Vasoactive Intestinal Peptide, guinea pig TFA |
| Sequence | His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH2 |
| Sequence Short | HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.